Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate WP_012384040.1 BIND_RS05275 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >NCBI__GCF_000019845.1:WP_012384040.1 Length = 392 Score = 234 bits (597), Expect = 3e-66 Identities = 137/372 (36%), Positives = 193/372 (51%), Gaps = 8/372 (2%) Query: 5 EILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEARGY 64 ++L L+ F + N +V+ + YL + +P EGD++ +F +IGPK G Sbjct: 16 DMLECLISFDTESSKSNLPLVAAVEDYLREQAVDYVKVPNAEGDKAALFISIGPKVDGGV 75 Query: 65 IISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRP 124 ++SGH DVVP WTSDPF LR EADR++GRGT DMKGF A LA +P+ L RP Sbjct: 76 VLSGHTDVVPVEGQSWTSDPFTLRREADRVFGRGTCDMKGFDALCLAMIPEFKQARLARP 135 Query: 125 LHLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGR 184 +H+ LSYDEE C G IAR +P ++GEPT M+ AHK A R TV G Sbjct: 136 IHILLSYDEEIACTGSLDTIARFGHDLPRPAAVLVGEPTLMQVADAHKSVATYRTTVHGH 195 Query: 185 SGHSSRPDQGLNAIHGVAGVLTQAVAEADRLVG-GPFEHVFEPPYSSLQIGTVKGGQAVN 243 HSS+P G +A+ ++T+ A+ L G F+PP S++ +GT+ GG A N Sbjct: 196 EAHSSKPYLGASAVEAGCDLVTELYRFAEVLAAEGDPSGRFDPPASTIHVGTIHGGTARN 255 Query: 244 IIPDSCEVEFEARAISGVDPAELLAPVRKTAEALTTLGF-------EVEWQELSAYPALS 296 I+ C +E R + GV L + A + +E P L+ Sbjct: 256 ILAKECSFLWEFRGLPGVAQDRALRHLEDYAARVVLPKMTRYAPKASIETLVEVEVPGLA 315 Query: 297 LEPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYILID 356 E + +L +L V + TEAG FQ+A + I+CGPG I +AH+PDEYI I Sbjct: 316 PETGSQAESLALKLARSNRTITVPFATEAGQFQKAEVPTIVCGPGSIDQAHQPDEYIAIA 375 Query: 357 ELMACRAMVEAL 368 ++ A A + L Sbjct: 376 QIEAGIAFMRRL 387 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 392 Length adjustment: 30 Effective length of query: 344 Effective length of database: 362 Effective search space: 124528 Effective search space used: 124528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012384040.1 BIND_RS05275 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.19843.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-115 371.8 0.0 2.1e-115 371.6 0.0 1.0 1 lcl|NCBI__GCF_000019845.1:WP_012384040.1 BIND_RS05275 acetylornithine dea Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000019845.1:WP_012384040.1 BIND_RS05275 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 371.6 0.0 2.1e-115 2.1e-115 2 364 .. 17 387 .. 16 388 .. 0.97 Alignments for each domain: == domain 1 score: 371.6 bits; conditional E-value: 2.1e-115 TIGR01892 2 ilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDv 70 +l+ L++fd+ s +sn++l+ vedyl+e+ v ++p+a+g +k l+ +iGpk+ +gg+vlsGhtDv lcl|NCBI__GCF_000019845.1:WP_012384040.1 17 MLECLISFDTESSKSNLPLVAAVEDYLREQAVDYVKVPNAEG-DKAALFISIGPKV-DGGVVLSGHTDV 83 6889**************************************.************9.9*********** PP TIGR01892 71 vPvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGak 139 vPv++++WtsDpf+L+ +++r++grGt+DmkGF al La +p+ ++a+L +P+h++ls+Dee++++G lcl|NCBI__GCF_000019845.1:WP_012384040.1 84 VPVEGQSWTSDPFTLRREADRVFGRGTCDMKGFDALCLAMIPEFKQARLARPIHILLSYDEEIACTGSL 152 ********************************************************************* PP TIGR01892 140 klieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlva 205 + i++ +rpa ++vGePt ++ ahk a+ + tv+G+e+hss+p G+sa+e +l+++l + lcl|NCBI__GCF_000019845.1:WP_012384040.1 153 DTIARFGhdlPRPAAVLVGEPTLMQVADAHKSVATYRTTVHGHEAHSSKPYLGASAVEAGCDLVTELYR 221 ****988788*********************************************************** PP TIGR01892 206 ladklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee.. 271 a+ l +d+ F+pp +t+++Gt++GG+a ni+a++C + e+R +pG+ ++ l +le+ a+ lcl|NCBI__GCF_000019845.1:WP_012384040.1 222 FAEVLAAeGDPSGRFDPPASTIHVGTIHGGTARNILAKECSFLWEFRGLPGVAQDRALRHLEDYAARvv 290 *****87699*****************************************************999966 PP TIGR01892 272 ...vkekapgfevkveelsatpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvlGP 336 +++ ap+ +++ + p+l++e ++++ l+ kla + ++ +v+++teag++q++ ++++v+GP lcl|NCBI__GCF_000019845.1:WP_012384040.1 291 lpkMTRYAPKASIETLVEVEVPGLAPETGSQAESLALKLARSnRTITVPFATEAGQFQKAEVPTIVCGP 359 66666788899999999999******************99876999*********************** PP TIGR01892 337 GdidqahqpdeYveieelkrcrallerl 364 G+idqahqpdeY+ i +++++ a+++rl lcl|NCBI__GCF_000019845.1:WP_012384040.1 360 GSIDQAHQPDEYIAIAQIEAGIAFMRRL 387 *************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (392 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.92 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory