Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_012386117.1 BIND_RS16265 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000019845.1:WP_012386117.1 Length = 410 Score = 175 bits (443), Expect = 2e-48 Identities = 117/390 (30%), Positives = 202/390 (51%), Gaps = 18/390 (4%) Query: 6 NPKAREIEISGIRKFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNA 65 +P+A SGI + + +I L +G+ D TP + AA +++ E T YT A Sbjct: 19 SPEALAAPESGIVEVFAYGRGRQGLIPLFVGEGDLPTPPFIVEAASRSLTEGETFYTYQA 78 Query: 66 GYLELRQAVQLYMKKKADFNYD------AESEIIITTGASQAIDAAFRTILSPGDEVIMP 119 G ELR A+ YM + Y+ + + +T G A+ A R + +EVI+P Sbjct: 79 GVPELRAAIAAYMSRHYGAIYERTVAPFSPEQFFVTIGGMHALQIALRLVARADEEVIVP 138 Query: 120 GPIYPGYEPIINLCGAKPVIV-----DTTSHGFKLTARLIEDALTPNTKCVVLPYPSNPT 174 P +P + +++ GA+P+ V + S G+ L IE ++TP T+C+++ PSNPT Sbjct: 139 TPAWPNFHGALSVLGARPITVPMLFQNNGSPGWTLDFDRIEASITPATRCLIVNTPSNPT 198 Query: 175 GVTLSEEELKSIAALLKGRNVFVLSDEIYSELTYD---RPHYSIATYLRDQTIVINGLSK 231 G S ++L+++ AL + +++++DEIY +T++ P + D + + SK Sbjct: 199 GWVASLKDLETLLALTRRHGLWLVADEIYGRMTFNGERAPSFHDIMEKDDNILFLQTFSK 258 Query: 232 SHSMTGWRIGFLFAPKDIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYK 291 + +MTG R+G+L AP+ +A I + QY+ S + Q+AA A+ G D + Sbjct: 259 NWAMTGLRLGWLEAPRSLAPIIENLIQYSTSGVAVPWQRAATVALEQGEDFFQQSLRRIH 318 Query: 292 KRLDYVYDRLVSMG-LDVVKPSGAFYIFPSIKSFGMT-SFDFSMALLEDAGVALVPGSSF 349 + +Y+ L G + +P GAFY+F K G T + ++ L+++A V + PG++F Sbjct: 319 QGRTILYEGLKKTGRIIAAEPEGAFYLF--CKVMGETDTRQLALRLIDEANVGVAPGTAF 376 Query: 350 STYGEGYVRLSFACSMDTLREGLDRLELFV 379 GE ++RL FA L E + RL L++ Sbjct: 377 GPGGEEFLRLCFARDPALLTEAVRRLSLWL 406 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 410 Length adjustment: 31 Effective length of query: 362 Effective length of database: 379 Effective search space: 137198 Effective search space used: 137198 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory