Align aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_012386503.1 BIND_RS18300 amino acid aminotransferase
Query= BRENDA::P04693 (397 letters) >NCBI__GCF_000019845.1:WP_012386503.1 Length = 407 Score = 364 bits (935), Expect = e-105 Identities = 189/396 (47%), Positives = 253/396 (63%), Gaps = 3/396 (0%) Query: 2 FQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQPH 61 F V DP+L + E F D KVNL +G+Y +E+G +P L V +AE L + Sbjct: 5 FAHVQQLPRDPVLGITEAFVADSSPRKVNLGVGVYLDENGHVPLLDCVQQAEEEL-LRRK 63 Query: 62 GASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFPE 121 G Y+P++G+ + +A+A L+F + P L +R+ T+Q LGG+GALK+GADFL+ P Sbjct: 64 GPHSYVPIDGIAAFDNAVASLIFSGERPSL-DERLVTVQALGGTGALKLGADFLRTTNPS 122 Query: 122 SGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHPC 181 + +W+SDP+WENH A+F+ AGFEV TYP+Y A G+ F L+ TL +LP+ I+LLH C Sbjct: 123 ARIWISDPSWENHRALFSAAGFEVETYPYY-RADGGLDFAGLIQTLSSLPSGDILLLHAC 181 Query: 182 CHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPALV 241 CHNPTG DL QW + + R +IPFLD AY GF G++ D AI A AGLP LV Sbjct: 182 CHNPTGLDLEPYQWAEIQALAAERGVIPFLDAAYLGFADGLDADRVAIDTFAQAGLPFLV 241 Query: 242 SNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLND 301 S SFSK SLYGERVG L+V+ A G VL Q+K R YSSPP+ G VA +LN+ Sbjct: 242 SFSFSKSLSLYGERVGALAVVTGGAAERGPVLSQIKRIARTTYSSPPSHGGATVATILNE 301 Query: 302 EALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVDR 361 L A W E+ MR RI AMR+ L + L ++P+R+F ++ QRGMFSY+GLS V+ Sbjct: 302 PGLTALWHDELALMRDRIKAMREGLAERLRVQVPDRDFSFITRQRGMFSYSGLSKEAVEM 361 Query: 362 LREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397 LR F +Y + SGR+CVA LN AN+ VA+A A V+ Sbjct: 362 LRSRFSIYALDSGRICVAALNKANLDIVAEAIATVL 397 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 407 Length adjustment: 31 Effective length of query: 366 Effective length of database: 376 Effective search space: 137616 Effective search space used: 137616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory