GapMind for Amino acid biosynthesis

 

Alignments for a candidate for leuD in Paraburkholderia phymatum STM815

Align 3-isopropylmalate dehydratase small subunit 1; EC 4.2.1.33; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1 (uncharacterized)
to candidate WP_012403640.1 BPHY_RS21890 aconitate hydratase AcnA

Query= curated2:Q9WYC8
         (166 letters)



>NCBI__GCF_000020045.1:WP_012403640.1
          Length = 905

 Score = 48.9 bits (115), Expect = 2e-10
 Identities = 34/102 (33%), Positives = 52/102 (50%), Gaps = 12/102 (11%)

Query: 54  IIVAGKNFGLGSSREHAARIIKIAGVSCIVAKSFARIFYRNAINVGLPVIELKEVDEI-- 111
           +I AG+ +G GSSR+ AA+  ++ GV  +VA+SF RI   N + +G+  ++ K  D I  
Sbjct: 777 VIFAGEEYGTGSSRDWAAKGTQLLGVKAVVARSFERIHRSNLVGMGVLPLQFKGSDSIQS 836

Query: 112 -NQGDELEIDLENGVLKNLTTGKEYRFTPIPKFLLEILKEDG 152
            N   E   D+E         G    F P  +  L I ++DG
Sbjct: 837 LNITGEETYDIE---------GLGDDFKPQQEVTLVIHRKDG 869



 Score = 25.4 bits (54), Expect = 0.003
 Identities = 8/12 (66%), Positives = 12/12 (100%)

Query: 9   FGDNISTDHIAP 20
           FGD+++TDHI+P
Sbjct: 674 FGDSVTTDHISP 685


Lambda     K      H
   0.321    0.141    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 366
Number of extensions: 18
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 166
Length of database: 905
Length adjustment: 30
Effective length of query: 136
Effective length of database: 875
Effective search space:   119000
Effective search space used:   119000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory