Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_012406806.1 BPHY_RS38395 homoserine O-succinyltransferase
Query= SwissProt::Q0BX37 (305 letters) >NCBI__GCF_000020045.1:WP_012406806.1 Length = 301 Score = 355 bits (910), Expect = e-103 Identities = 161/295 (54%), Positives = 210/295 (71%) Query: 1 MPIRIPDTLPARETLLKEGVAVMTETDAVRQDIRPLQIALLNLMPNKIRTETQIARLIGA 60 MPI++P LPA L EG+ VM + + RPL + LLNLMPNKI TE QIARL+GA Sbjct: 1 MPIKVPKGLPAVTVLQTEGITVMADDSVLCPRDRPLHVGLLNLMPNKIETEIQIARLLGA 60 Query: 61 SPLQVELTLVRVGGHTPKNTSQEHLISFYQTWEEIRERKFDGFIITGAPIEQMPFEEVNY 120 +P+ V+LTL+++ H+PKNT HL +FY+ W ++ E+ FDGFIITGAP+E +PFE+V Y Sbjct: 61 TPILVDLTLIKIASHSPKNTPVSHLTTFYRDWIDVMEQVFDGFIITGAPVESIPFEQVAY 120 Query: 121 WEELTQIFDWTQTNVHSPFYICWGAMAAAYHFHGLPKYQLEAKAFGVFRHRNLDLASPYL 180 W E +I +WTQTN S F ICW A AA +HFHGLPKY L KAFG+FRHR+L+ SPYL Sbjct: 121 WNEFVEILNWTQTNARSCFNICWAAQAAMHHFHGLPKYALTEKAFGIFRHRSLESTSPYL 180 Query: 181 SGFSDDFAIPVSRWTEVRRADVLERQSLRLLIDSDDTGPCLLEDRARRSLYMFNHVEYDS 240 GFSDDF IPVSRWTE+R D+ + +L++S +TG CLL+D SL++FNH+EYDS Sbjct: 181 QGFSDDFFIPVSRWTEMRSTDIPSSSGISVLMESPETGLCLLDDPKHHSLHIFNHIEYDS 240 Query: 241 FSLKEEFERDREAGKQIQVPFGYYPGDDPARQPLNRWRSHAHLLFGNWINQTYQS 295 +L +E+ RDR G++ +P Y D +P N WRSHAHLLFGNW+ Q Y++ Sbjct: 241 QTLADEYFRDRSIGRRTSLPKNYLSDDYETLRPRNCWRSHAHLLFGNWVGQIYKT 295 Lambda K H 0.322 0.138 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 301 Length adjustment: 27 Effective length of query: 278 Effective length of database: 274 Effective search space: 76172 Effective search space used: 76172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory