Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_012411281.1 NPUN_RS25190 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000020025.1:WP_012411281.1 Length = 433 Score = 263 bits (672), Expect = 1e-74 Identities = 163/434 (37%), Positives = 244/434 (56%), Gaps = 16/434 (3%) Query: 365 SDKVGVQKALSRPIQKT--SEIMH---LVNPIIENVRDKGNSALLEYTEKFDGVKLSNPV 419 + + V+ L R +T +++H V +++ V+ +G+ A+L YT +FD L Sbjct: 6 TQQADVRAELQRICDRTHDEQVLHKEATVREVLQAVKRQGDKAVLHYTAEFDKQTLKAEE 65 Query: 420 LNAPFPE--EYFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPI 477 L E ++ +++E+ A+ L+ + FH ++P + VL R+ P+ Sbjct: 66 LRVTGSELDAAYQQVSKELLGAVRLACRQIEAFHRQRVPKSWVHFGDDEVVLGKRYT-PV 124 Query: 478 EKVGLYIPGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGAS 537 ++ GLY+PGG A PST LM +PA VA IV +PP G ++P V+ A++ G Sbjct: 125 DRAGLYVPGGRAAYPSTVLMNAIPAHVAAVPHIVMVTPPGPG-GVINPAVLVAAQEAGVQ 183 Query: 538 KIVLAGGAQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSE 597 +I GGAQA+AA+AYGTETIPKV+ I GPGN +VT AK V ID AGPSE Sbjct: 184 EIYRIGGAQAIAALAYGTETIPKVNVITGPGNIYVTLAKKLVYGTV----GIDSLAGPSE 239 Query: 598 VLVIADEDADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVD 657 VLVIADE A+ VA+DLL+QAEH + IL+ + + K +Q A+ Q + PR Sbjct: 240 VLVIADESANAVHVAADLLAQAEHDPMAAAILLTTDAALAK--NVQVALERQLVDHPRRI 297 Query: 658 IVRKCIAH-STIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTP 716 K IAH IVL + + A E+SN++APEHL L++ + + + +AG++F+G TP Sbjct: 298 DTEKAIAHYGLIVLVESLQAAAELSNEFAPEHLELEVKDPWALLPEIRHAGAIFLGYSTP 357 Query: 717 ESCGDYSSGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEG 776 E+ GDY +G NHTLPT G AR S TF K + + L+N+ A+ +A EG Sbjct: 358 EAVGDYLAGPNHTLPTSGAARYASALGVETFLKHSSIIQYSQTALQNVAGAIDVLATAEG 417 Query: 777 LDGHRNAVKIRMSK 790 L H ++V+ R+ + Sbjct: 418 LPSHADSVRRRIQQ 431 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 662 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 433 Length adjustment: 37 Effective length of query: 762 Effective length of database: 396 Effective search space: 301752 Effective search space used: 301752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory