Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate WP_012411293.1 NPUN_RS25255 amidase
Query= curated2:Q72L58 (471 letters) >NCBI__GCF_000020025.1:WP_012411293.1 Length = 467 Score = 187 bits (475), Expect = 6e-52 Identities = 148/478 (30%), Positives = 231/478 (48%), Gaps = 48/478 (10%) Query: 3 AHEIRARVARGEVSPLEVAQAYLKRVQELDPGLGAFLSLNERL-LEEAEAVDPGL----- 56 A E+ + R EVSPLE+ + YL+R+++L+P LG++ ++ L + +A+A L Sbjct: 11 ALELAQLIRRREVSPLELVEIYLERIEQLNPQLGSYFTVTAELAIADAKAKTELLTTTSE 70 Query: 57 --PLAGLVVAVKDNIATRGLRTTAGSRLLENFVPPYEATAVARLKALGALVLGKTNLDEF 114 P G+ +++KD A + T G+ L N +P Y+ V R+K G +LGKT E Sbjct: 71 LPPFFGVPISIKDLNAVADVTCTYGNPALLNNIPNYDDGVVTRIKQAGFTILGKTATSEL 130 Query: 115 GMGSSTEHSAFFPTKNPFDPDRVPGGSSGGSAAALAADLAPLALGSDTGGSVRQPAAFCG 174 G +E +AF P +NP++ + PGGSSGG+AAA+AA L +A GSD GGS+R PAA CG Sbjct: 131 GSFPYSEPTAFPPARNPWNLEYTPGGSSGGAAAAVAAGLCAIAQGSDGGGSIRGPAACCG 190 Query: 175 VYGLKPTYGRVSRFGLIAYASSLDQIGPMARSVRDLALLMDAVAGPDPLDATSL-DLPPR 233 + GLKP+ GRVS+ + + + GP+AR+V D A ++D ++G D L D P Sbjct: 191 LVGLKPSRGRVSKAPVGERLAGIAVNGPIARTVADAAAVLDTISGYVTGDPYWLPDPEPS 250 Query: 234 FQEALEGPLPPLRLGVVR--EALAGNSPGVERALEEALKVFRELGLSVREVSWPSLPQAL 291 F A + L LR+ L ++ + + +++ +LG V + S P + Sbjct: 251 FLAATQTKLGALRIAFDTNISPLGEADANCQQGVRQTVQLLEQLGHHVEQRS-PDFSGLV 309 Query: 292 AAYYILAPAEASSNLARYDGTLYGRRAEGEEVEGMMEATRALFGLEVKRRVLVGTFVLSS 351 + I+ A G A G VE + R LF G+ Sbjct: 310 EPFQIVWQA--------------GVAASGLPVEALQPLNRWLF-------ARTGSV---- 344 Query: 352 GYYEAYYGRAQAFRRRLKAEAQALFREVDLLLLPTTPHPAFPFG--ARRDPLAMYREDLY 409 A Y +A + + + + A F VD+L+LP H G A P ++ + Sbjct: 345 ----AQYLQAVSQMQVVARQIVAFFDTVDVLVLPVYLHSPIRVGEWASLSPEETFQNIIE 400 Query: 410 TVG----ANLTGLPALSFPAGFEGH-LPVGLQLLAPWGEDERLLRAALAFEEATARAH 462 + AN TG PA++ P GF+ LP+ +QL+ + L+ A E A H Sbjct: 401 WIAPCPPANATGQPAIAIPVGFDSKGLPISVQLIGKPAAEATLINLAAQLEAANPWIH 458 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 471 Length of database: 467 Length adjustment: 33 Effective length of query: 438 Effective length of database: 434 Effective search space: 190092 Effective search space used: 190092 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory