Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_012412172.1 NPUN_RS30050 phosphoglycerate kinase
Query= BRENDA::P36204 (654 letters) >NCBI__GCF_000020025.1:WP_012412172.1 Length = 400 Score = 447 bits (1149), Expect = e-130 Identities = 226/394 (57%), Positives = 290/394 (73%), Gaps = 4/394 (1%) Query: 5 TIRDVDLKGKRVIMRVDFNVPVKD-GVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRP 63 ++ D+ GKR ++RVDFNVPV D G + DDTRIRAALPTI+ ++GAKVIL SH GRP Sbjct: 8 SLSSADISGKRALVRVDFNVPVDDQGKITDDTRIRAALPTIQDLTQKGAKVILASHFGRP 67 Query: 64 KGEPSPEFSLAPVAKRLSELLGKEVKFVPAVVGDEVKKAVEELKEGEVLLLENTRFHPGE 123 KG + L PVAKRLSELLG+EV +GDEV V L+ G+VLLLEN RF+P E Sbjct: 68 KGVDD-KLRLTPVAKRLSELLGQEVIKTDDSIGDEVAAKVAALQNGQVLLLENVRFYPEE 126 Query: 124 TKNDPELAKFWASLADIHVNDAFGTAHRAHASNVGIAQFI-PSVAGFLMEKEIKFLSKVT 182 KND E AK A+ AD +VNDAFGTAHRAHAS G+ +F+ PSVAG+L+EKE+++L Sbjct: 127 EKNDAEFAKKLAANADFYVNDAFGTAHRAHASTEGVTKFLSPSVAGYLVEKELQYLQNAI 186 Query: 183 YNPEKPYVVVLGGAKVSDKIGVITNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDK 242 NP++P ++GG+KVS KIGVI L+EK D+++IGG M+FTF KA G VG S VEEDK Sbjct: 187 ENPQRPLAAIIGGSKVSSKIGVIETLLEKCDKLIIGGGMIFTFYKARGLSVGKSLVEEDK 246 Query: 243 IDLAKELLEKAKEKGVEIVLPVDAVIAQKIEPGVEKKVVRIDDGIPEGWMGLDIGPETIE 302 ++LAK L KAKE+GV ++LP D V+A P + V I++ IP+GWMGLDIGP++++ Sbjct: 247 LELAKSLEAKAKERGVALLLPTDVVLADNFAPDANSQTVSIEN-IPDGWMGLDIGPDSVK 305 Query: 303 LFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAALTEKGAITVVGGGDSAAAVNK 362 F++ L+D KTV+WNGPMGVFE D FA GT+ +A +A + + G T++GGGDS AAV K Sbjct: 306 FFQEALADTKTVIWNGPMGVFEFDKFAAGTEAIAHTLAEIGKTGTTTIIGGGDSVAAVEK 365 Query: 363 FGLEDKFSHVSTGGGASLEFLEGKELPGIASIAD 396 GL D+ SH+STGGGASLE LEGK LPGIA++ D Sbjct: 366 VGLADQMSHISTGGGASLELLEGKVLPGIAALDD 399 Lambda K H 0.317 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 725 Number of extensions: 40 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 654 Length of database: 400 Length adjustment: 34 Effective length of query: 620 Effective length of database: 366 Effective search space: 226920 Effective search space used: 226920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory