Align diaminopimelate decarboxylase subunit (EC 4.1.1.20) (characterized)
to candidate WP_012412220.1 NPUN_RS30310 diaminopimelate decarboxylase
Query= metacyc::MONOMER-6601 (439 letters) >NCBI__GCF_000020025.1:WP_012412220.1 Length = 465 Score = 383 bits (983), Expect = e-111 Identities = 202/426 (47%), Positives = 281/426 (65%), Gaps = 6/426 (1%) Query: 6 TSRQNQHGHLEIGGVDALYLAEKYGTPLYVYDVALIRERAKSFKQAFISAGL-KAQVAYA 64 T+R + H LEIGG D L +++G+PLY+ D +R + ++ AF ++QV YA Sbjct: 37 TARVHNHDSLEIGGCDVTTLVKQFGSPLYILDEETLRSACQQYRDAFKQYYKGESQVLYA 96 Query: 65 SKAFSSVAMIQLAEEEGLSLDVVSGGELYTAVAAGFPAERIHFHGNNKSREELRMALEHR 124 SKA++ +A+ +A EGL +DVVSGGELYTA+ AG E+I+ HGNNKSREEL +A+E Sbjct: 97 SKAWNCLAVCAIAASEGLGIDVVSGGELYTALQAGVSPEKIYLHGNNKSREELILAIESG 156 Query: 125 IGCIVVDNFYEIALLEDLCKETGHSIDVLLRITPGVEAHTHDYITTGQEDSKFGFDLHNG 184 + IV DN+YE+ L ++ + G SI ++LR+TPG+E HTH+YI TG DSKFGFD ++ Sbjct: 157 V-TIVADNWYELRTLVEIA-QPGQSIRIMLRLTPGIECHTHEYIRTGHLDSKFGFDPND- 213 Query: 185 QTERAIEQVLQSEHIQLLGVHCHIGSQIFDTAGFVLAAEKIFKKLDEWRDSYSFVSKVLN 244 + V Q + +GVH HIGSQIF+ A + + L + Y LN Sbjct: 214 -LDEVFTFVSQQSTLDCVGVHAHIGSQIFERQPHQDLAAVMVQWLRD-AGKYGLNITELN 271 Query: 245 LGGGFGIRYTEDDEPLHATEYVEKIIEAVKENASRYGFDIPEIWIEPGRSLVGDAGTTLY 304 +GGG GI+YTE D+P E+V+ I E V+E + +P++ EPGRSL+ A T Y Sbjct: 272 VGGGLGIKYTESDDPPSIEEWVKAICEVVQEACAVENLPLPKLLSEPGRSLIATACVTAY 331 Query: 305 TVGSQKEVPGVRQYVAVDGGMNDNIRPALYQAKYEAAAANRIGEAHDKTVSIAGKCCESG 364 TVGS K +P +R YVA+DGGM+DN RP YQ+ Y A AN++ +TV+IAGK CESG Sbjct: 332 TVGSSKVIPEIRTYVAIDGGMSDNPRPITYQSVYRAVVANKMSSPVTQTVTIAGKHCESG 391 Query: 365 DMLIWDIDLPEVKEGDLLAVFCTGAYGYSMANNYNRIPRPAVVFVENGEAHLVVKRETYE 424 D+LI + LP+ + GD+L V TGAY YSMA+NYNR+PRPA V V NGEA+L+++RETY+ Sbjct: 392 DILIKNALLPKTEPGDILVVMGTGAYNYSMASNYNRLPRPAAVVVANGEANLILQRETYQ 451 Query: 425 DIVKLD 430 D+++ D Sbjct: 452 DLIRQD 457 Lambda K H 0.319 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 465 Length adjustment: 33 Effective length of query: 406 Effective length of database: 432 Effective search space: 175392 Effective search space used: 175392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_012412220.1 NPUN_RS30310 (diaminopimelate decarboxylase)
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.1378.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-156 506.1 0.0 3.4e-156 505.8 0.0 1.0 1 lcl|NCBI__GCF_000020025.1:WP_012412220.1 NPUN_RS30310 diaminopimelate dec Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020025.1:WP_012412220.1 NPUN_RS30310 diaminopimelate decarboxylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 505.8 0.0 3.4e-156 3.4e-156 5 416 .. 42 457 .. 38 458 .. 0.97 Alignments for each domain: == domain 1 score: 505.8 bits; conditional E-value: 3.4e-156 TIGR01048 5 kdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafka...eeslvlYAvKAnsnlavlrlla 70 ++ +lei+g+d+++l+++fg+PlY++deetlr+++++++ afk+ es+vlYA+KA+++lav ++a lcl|NCBI__GCF_000020025.1:WP_012412220.1 42 NHDSLEIGGCDVTTLVKQFGSPLYILDEETLRSACQQYRDAFKQyykGESQVLYASKAWNCLAVCAIAA 110 56789**************************************9754445******************* PP TIGR01048 71 eeGlgldvvsgGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelg 139 +eGlg+dvvsgGEl++al+Agv++eki+++gn+ks+eel a+e++++ i++d++ el++l eia+ lcl|NCBI__GCF_000020025.1:WP_012412220.1 111 SEGLGIDVVSGGELYTALQAGVSPEKIYLHGNNKSREELILAIESGVT-IVADNWYELRTLVEIAQPG- 177 ***********************************************8.****************976. PP TIGR01048 140 kkarvllRvnpdvdaktheyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepf 208 +++r++lR++p+++++theyi TG+ +sKFG+++++ e++++++++++l++vG+h+HIGSqi++ +p+ lcl|NCBI__GCF_000020025.1:WP_012412220.1 178 QSIRIMLRLTPGIECHTHEYIRTGHLDSKFGFDPNDLDEVFTFVSQQSTLDCVGVHAHIGSQIFERQPH 246 ********************************************************************* PP TIGR01048 209 veaaekvvklleelkeegieleeldlGGGlgisyeeeeeapdleeyaeklleklekea.elgl.klkli 275 ++ a+ +v++l++ + g++++el++GGGlgi+y+e++++p++ee+++++ e +++++ +l +kl+ lcl|NCBI__GCF_000020025.1:WP_012412220.1 247 QDLAAVMVQWLRDAGKYGLNITELNVGGGLGIKYTESDDPPSIEEWVKAICEVVQEACaVENLpLPKLL 315 *************9999***************************************996556679**** PP TIGR01048 276 lEpGRslvanagvlltrVesvKeves.rkfvlvDagmndliRpalYeayheiaalkrleeeetetvdvv 343 EpGRsl+a+a+v+ ++V+s K ++ r++v++D+gm+d+ Rp++Y+++++ +++++++ t+tv+++ lcl|NCBI__GCF_000020025.1:WP_012412220.1 316 SEPGRSLIATACVTAYTVGSSKVIPEiRTYVAIDGGMSDNPRPITYQSVYRAVVANKMSSPVTQTVTIA 384 ************************999****************************************** PP TIGR01048 344 GplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevlveegkarlirrretledl 412 G++CEsgD+l+k+ lp++e+Gd+l+v+ +GAY++sm+snYn+ prpa+v+v +g+a+li++ret++dl lcl|NCBI__GCF_000020025.1:WP_012412220.1 385 GKHCESGDILIKNALLPKTEPGDILVVMGTGAYNYSMASNYNRLPRPAAVVVANGEANLILQRETYQDL 453 ********************************************************************* PP TIGR01048 413 lale 416 ++++ lcl|NCBI__GCF_000020025.1:WP_012412220.1 454 IRQD 457 *987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (465 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory