Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_012465631.1 CLIM_RS03365 cystathionine gamma-synthase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000020465.1:WP_012465631.1 Length = 381 Score = 372 bits (956), Expect = e-108 Identities = 194/379 (51%), Positives = 254/379 (67%), Gaps = 2/379 (0%) Query: 15 LSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSRTHNPTRFAYERCVA 74 + TLAIH GQ+PDP TG+V P++ TST+ + + F YSR NPTR A E +A Sbjct: 1 MQFETLAIHDGQTPDPQTGSVTVPVFQTSTFEREDLSHRREFFYSRIGNPTRQALESTLA 60 Query: 75 ALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLDFSFV 134 LE G AFASG AAT +++L G H+V+ D+YGGT+R+FE++ R G+ S+ Sbjct: 61 LLENGRFGLAFASGAAATMAALQVLRPGDHIVSALDIYGGTYRIFEQLLRPW-GIGISYA 119 Query: 135 DLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFASPMLQ 194 D ++ A I +TK++W+E+P+NP+L+L DI IA +AR+ G+L VDNTFASP Q Sbjct: 120 DNEAVESYAACIVPETKLIWLESPSNPLLRLSDIREIASLARERGILVAVDNTFASPYFQ 179 Query: 195 RPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFDSFLA 254 RPL LGAD+ VHS TKYL GHSD++GG V+ D A L + Q + G + GP+D +L Sbjct: 180 RPLELGADIAVHSTTKYLGGHSDVIGGAVVLNDPALLTTIKNY-QAAAGAIPGPWDCWLI 238 Query: 255 LRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGFGGIVS 314 +RG+KTL +RM+ H NAL LAQ LE HPA+E+V YPGL SHPQH LAKRQMSGF G+++ Sbjct: 239 MRGIKTLKIRMKEHEANALHLAQLLEGHPAVERVWYPGLPSHPQHELAKRQMSGFSGMLT 298 Query: 315 IVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVR 374 LKGG A + K +LF LA+SLGGVESLV PA MT ++ R + G SD LVR Sbjct: 299 FALKGGLPAVELLLAKLKLFALADSLGGVESLVASPAKMTLGALSAKERTKRGCSDNLVR 358 Query: 375 LSVGIEDLGDLRGDLERAL 393 +SVG+E GDL DL AL Sbjct: 359 MSVGLEYAGDLEADLLTAL 377 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 381 Length adjustment: 30 Effective length of query: 367 Effective length of database: 351 Effective search space: 128817 Effective search space used: 128817 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory