Align 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (characterized)
to candidate WP_012466952.1 CLIM_RS10335 4-hydroxy-tetrahydrodipicolinate reductase
Query= reanno::Pedo557:CA265_RS15670 (244 letters) >NCBI__GCF_000020465.1:WP_012466952.1 Length = 248 Score = 156 bits (395), Expect = 3e-43 Identities = 92/246 (37%), Positives = 143/246 (58%), Gaps = 10/246 (4%) Query: 1 MKLALLGYGKMGQIIEKFAVERG-HEIVLKITIDNQEDLTRQNLKSADVAIDFSTPDSVL 59 MK L G G+MGQ + G HEI +D++ +T ++ +D IDF+ D+ L Sbjct: 1 MKFTLTGSGRMGQQVADVINRSGIHEIAS--ILDDRSVVTAESFLGSDAIIDFTVRDAFL 58 Query: 60 KNIDACFDANVPIVVGTTGWYGKLQEVKDDCNNSNNTLLYGSNFSIGVNLFFKLNQTLAK 119 +N+ A + VP+VVGTTGW +++ VK S ++LLY +NFS+GVN+F + + A+ Sbjct: 59 QNLPAMLQSGVPVVVGTTGWDDQIESVKRRVIESGSSLLYSANFSLGVNIFLRTVREAAR 118 Query: 120 LMNNYPAYEVQVEEIHHTQKLDAPSGTAITLAEGIVDNLDRKQEWLNEVVGTDVELFPKA 179 L+ + +++ E HHT K D PSGTA+ AE I+ RK+ + E+ D ++ A Sbjct: 119 LIAPFDQFDIAFTEHHHTGKADFPSGTALRAAEMILSVNPRKRTIVRELF-DDRKI--TA 175 Query: 180 EQLLIESHRIENIPGTHTVIYSSEVDEIEIKHTAHNRAGFALGAVVAAEWLKDK----KG 235 ++L + + R+ ++ G HT SE+DEI I H A NR GFA GAV A+WL + G Sbjct: 176 DELQVGALRLGSVFGKHTAYIDSEMDEIVISHNAKNREGFASGAVQTAKWLAARHTASPG 235 Query: 236 FFSITD 241 F+++ D Sbjct: 236 FYTMDD 241 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 248 Length adjustment: 24 Effective length of query: 220 Effective length of database: 224 Effective search space: 49280 Effective search space used: 49280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_012466952.1 CLIM_RS10335 (4-hydroxy-tetrahydrodipicolinate reductase)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.2659.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-47 148.7 0.1 2e-47 148.0 0.1 1.3 1 lcl|NCBI__GCF_000020465.1:WP_012466952.1 CLIM_RS10335 4-hydroxy-tetrahydr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020465.1:WP_012466952.1 CLIM_RS10335 4-hydroxy-tetrahydrodipicolinate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 148.0 0.1 2e-47 2e-47 41 269 .. 14 243 .. 2 244 .. 0.84 Alignments for each domain: == domain 1 score: 148.0 bits; conditional E-value: 2e-47 TIGR00036 41 qgkDiGelagigkvgvpveddleavkvlaekkadvliDfttpeavlenvkialekgvrlVvGTTGfsee 109 q D+ + +gi ++ + + dd + v+ + d +iDft+ +a l+n+ ++l+ gv +VvGTTG +++ lcl|NCBI__GCF_000020465.1:WP_012466952.1 14 QVADVINRSGIHEIAS-ILDDRSVVTAESFLGSDAIIDFTVRDAFLQNLPAMLQSGVPVVVGTTGWDDQ 81 3356666677777777.7777776766668899*********************************876 PP TIGR00036 110 dlkelkdlaekkgvalviapNfaiGvnlllkllekaakv...ledvDiEiiElHHrhKkDaPSGTAlkl 175 ++++k + ++g +l++++Nf++Gvn++l+++++aa+ ++++Di E HH K+D PSGTAl++ lcl|NCBI__GCF_000020465.1:WP_012466952.1 82 -IESVKRRVIESGSSLLYSANFSLGVNIFLRTVREAARLiapFDQFDIAFTEHHHTGKADFPSGTALRA 149 .66676666666*************************983335677*********************** PP TIGR00036 176 aeiiakarg..kdlkeaaveeregltGerkkeeiGiaavRggdvvgehtvlFasdGerleitHkassRa 242 ae+i ++ +++ +++ + r++ + +e + a+R+g v g+ht + s+ + + i+H+a++R+ lcl|NCBI__GCF_000020465.1:WP_012466952.1 150 AEMILSVNPrkRTIVRELFDDRKITA-----DELQVGALRLGSVFGKHTAYIDSEMDEIVISHNAKNRE 213 ****9886522667777777777666.....677788******************************** PP TIGR00036 243 afakGvvrairwledkee...kvydledvl 269 fa+G+v++++wl+ ++ ++y+++d+l lcl|NCBI__GCF_000020465.1:WP_012466952.1 214 GFASGAVQTAKWLAARHTaspGFYTMDDFL 243 *************876543469******98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (248 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 2.03 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory