Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_012468444.1 GLOV_RS01700 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_000020385.1:WP_012468444.1 Length = 427 Score = 255 bits (651), Expect = 2e-72 Identities = 158/422 (37%), Positives = 226/422 (53%), Gaps = 41/422 (9%) Query: 12 DRALSLATLAIHGGQSPDPSTGAVMPPIYATST-------YAQSSPGEHQGFEYSRTHNP 64 D L TLAI GG P ++P + +T+ A+ E GF Y+R NP Sbjct: 2 DTNWKLETLAIQGGYEPKAGEARIVPIVQSTTFKYDDADYVAKLFDLEVPGFFYTRLGNP 61 Query: 65 TRFAYERCVAALEGGTRAFAFASGMAA-TSTVMELLDAGSHVVAMDDLYGGTFRLFERVR 123 T A+E+ +A +EGG A A +SG AA T ++ + AG H+V+ LYGGT+ LF Sbjct: 62 TADAFEKKIAQMEGGVAALATSSGQAAITLAMLNICQAGQHIVSASTLYGGTYNLFSSTL 121 Query: 124 RRTAGLDFSFVDLTDPAA-FKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLT 182 + G++ +FV+ PA AA R T+ ++ ET NP + ++D A +A+ + Sbjct: 122 PKL-GIEVTFVNPDAPAEEIAAAFRPTTRALYAETIGNPGMNVLDFEKFASVAKAQQVPL 180 Query: 183 VVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVG-----DNAELAEQM-- 235 V+DNT A+P L RP LGA++VVHSATKY++GH+ +GG+ V G DN + E + Sbjct: 181 VIDNTMATPYLCRPFELGANIVVHSATKYIDGHATSLGGVIVDGGTFNWDNGKFPELVEP 240 Query: 236 -----------------------AFLQNSIGGVQGPFDSFLALRGLKTLPLRMRAHCENA 272 L +G P ++FL GL TLPLRM+ H ENA Sbjct: 241 DASYHGMQYVKTFGPAAYIIKARVQLMRDLGATVAPMNAFLFNLGLHTLPLRMQRHSENA 300 Query: 273 LALAQWLETHPAIEKVIYPGLASHPQHVLAKRQM-SGFGGIVSIVLKGGFDAAKRFCEKT 331 LALA+ LE HPA+ YPGLASH H A++ + G G+++ +KGG A K+F E Sbjct: 301 LALARHLEAHPAVSWACYPGLASHSSHGRAQKYLPKGASGVLTFGIKGGAAAGKKFMEAC 360 Query: 332 ELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDLER 391 +L L +G S V HPA TH + ++ G+S L+RLSVGIE + DL D+++ Sbjct: 361 KLIALVVHVGDARSCVLHPASTTHRQLSEEQQLSSGVSPDLIRLSVGIEHIDDLIADVDQ 420 Query: 392 AL 393 AL Sbjct: 421 AL 422 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 397 Length of database: 427 Length adjustment: 31 Effective length of query: 366 Effective length of database: 396 Effective search space: 144936 Effective search space used: 144936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory