Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate WP_012468444.1 GLOV_RS01700 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= SwissProt::P55218 (403 letters) >NCBI__GCF_000020385.1:WP_012468444.1 Length = 427 Score = 256 bits (654), Expect = 9e-73 Identities = 147/423 (34%), Positives = 235/423 (55%), Gaps = 48/423 (11%) Query: 20 DTLAVRAGQRRTPEGEHGEA----LFTTSSYVFRTAADAAARFAGEVPGNVYSRYTNPTV 75 +TLA++ G E + GEA + ++++ + A A F EVPG Y+R NPT Sbjct: 8 ETLAIQGGY----EPKAGEARIVPIVQSTTFKYDDADYVAKLFDLEVPGFFYTRLGNPTA 63 Query: 76 RTFEERIAALEGAEQAVATASGMSAILALVMSLCSSGDHVLVSRSVFGSTISLFDKYFKR 135 FE++IA +EG A+AT+SG +AI ++++C +G H++ + +++G T +LF + Sbjct: 64 DAFEKKIAQMEGGVAALATSSGQAAITLAMLNICQAGQHIVSASTLYGGTYNLFSSTLPK 123 Query: 136 FGIQVDY----PPLSDLAAWEAACKPNTKLFFVESPSNPLAELVDIAALAEIAHAKGALL 191 GI+V + P ++AA A +P T+ + E+ NP ++D A +A A+ L Sbjct: 124 LGIEVTFVNPDAPAEEIAA---AFRPTTRALYAETIGNPGMNVLDFEKFASVAKAQQVPL 180 Query: 192 AVDNCFCTPALQQPLKLGADVVIHSATKYIDGQGRGMGGVVAGRGE-------------- 237 +DN TP L +P +LGA++V+HSATKYIDG +GGV+ G Sbjct: 181 VIDNTMATPYLCRPFELGANIVVHSATKYIDGHATSLGGVIVDGGTFNWDNGKFPELVEP 240 Query: 238 ------------------QMKEVVGFLRTAGPTLSPFNAWLFLKGLETLRIRMQAHSASA 279 +K V +R G T++P NA+LF GL TL +RMQ HS +A Sbjct: 241 DASYHGMQYVKTFGPAAYIIKARVQLMRDLGATVAPMNAFLFNLGLHTLPLRMQRHSENA 300 Query: 280 LALAEWLERQPGIERVYYAGLPSHPQHELARRQ-QSGFGAVVSFDVKGGRDAAWRFIDAT 338 LALA LE P + Y GL SH H A++ G V++F +KGG A +F++A Sbjct: 301 LALARHLEAHPAVSWACYPGLASHSSHGRAQKYLPKGASGVLTFGIKGGAAAGKKFMEAC 360 Query: 339 RMVSITTNLGDTKTTIAHPATTSHGRLSPEDRARAGIGDSLIRVAVGLEDLDDLKADMAR 398 +++++ ++GD ++ + HPA+T+H +LS E + +G+ LIR++VG+E +DDL AD+ + Sbjct: 361 KLIALVVHVGDARSCVLHPASTTHRQLSEEQQLSSGVSPDLIRLSVGIEHIDDLIADVDQ 420 Query: 399 GLA 401 LA Sbjct: 421 ALA 423 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 427 Length adjustment: 31 Effective length of query: 372 Effective length of database: 396 Effective search space: 147312 Effective search space used: 147312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory