Align Methionine synthase component, B12 binding and B12-binding cap domains (EC:2.1.1.13) (characterized)
to candidate WP_012470188.1 GLOV_RS10575 methionine synthase
Query= reanno::Phaeo:GFF1319 (233 letters) >NCBI__GCF_000020385.1:WP_012470188.1 Length = 1169 Score = 118 bits (295), Expect = 6e-31 Identities = 72/205 (35%), Positives = 110/205 (53%), Gaps = 8/205 (3%) Query: 26 LYDGLKEEIEESVNILLERGWAPYKVLTEALVGGMTIVGADFRDGILFVPEVLLAANAMK 85 + +G K+ + ++ L RG P +++ L+ GM VG F D L V EVL +A AMK Sbjct: 640 IIEGSKDGLTADLDAALTRGDKPLEIINGPLMAGMAEVGRLFNDNQLIVAEVLQSAEAMK 699 Query: 86 GGMAILKPLLAETGAPRMGSMVIGTVKGDIHDIGKNLVSMMMEGAGFEVVDIGINNPVEN 145 ++ L+P L++ G M++ TVKGD+HDIGKNLV +++ GFEV+++GI E Sbjct: 700 AAVSHLEPHLSKDETSSKGKMLLATVKGDVHDIGKNLVEIILSNNGFEVINLGIKVGPEE 759 Query: 146 YLEALEEHQPDILGMSALLTTTMPYMKVVIDTMIEQGKRDDYIVLVGGAPLNEEFG---- 201 + A ++ PD +G+S LL + M V + G D +LVGGA L+ F Sbjct: 760 LIAAAKKENPDFIGLSGLLVKSALQMIVTAADLKAAG--IDAPLLVGGAALSRAFADTRI 817 Query: 202 --KAIGADGYCRDAAVAVEMAKDFV 224 + G Y +DA +E+A V Sbjct: 818 TPEYNGPVLYAKDAMAGLELANQLV 842 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 552 Number of extensions: 25 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 1169 Length adjustment: 34 Effective length of query: 199 Effective length of database: 1135 Effective search space: 225865 Effective search space used: 225865 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory