Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_012470330.1 GLOV_RS11290 threonine synthase
Query= BRENDA::Q8YFS0 (463 letters) >NCBI__GCF_000020385.1:WP_012470330.1 Length = 460 Score = 412 bits (1060), Expect = e-120 Identities = 213/436 (48%), Positives = 286/436 (65%), Gaps = 2/436 (0%) Query: 1 MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT 60 M+Y+STRG + F DA++ GLA DGGL LP+ P F+A ++ + R +Y ++A +++ Sbjct: 1 MRYLSTRGGIAPVRFKDAVMMGLADDGGLLLPESIPAFSAAELESWRTLTYPQLAFKIIS 60 Query: 61 PFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELFHGPTLAFKDVAMQLLA 120 F +IPA D + ++ +Y TF H V P+VQ D ++LELFHG TLAFKDVA+Q L Sbjct: 61 RFVD-DIPATDLQALIDRSYATFSHPEVTPVVQKDG-VYILELFHGVTLAFKDVALQFLG 118 Query: 121 RMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQMTSS 180 + +Y+L +R ER TIVGATSGDTG AAI G+ IFIL P+G+ SPVQ QMTS Sbjct: 119 NLFEYILHERHERLTIVGATSGDTGSAAIHGVRGKAGISIFILHPHGKTSPVQALQMTSV 178 Query: 181 GFSNVHALSIEGNFDDCQNLVKGMFNDLEFCDALSLSGVNSINWARIMPQVVYYFTAALS 240 NVH ++++G FDDCQ++VKG+ DLEF SL VNSINWAR++ QVVYY A L Sbjct: 179 LDENVHNIAVDGTFDDCQDIVKGLMGDLEFKQKYSLGAVNSINWARVLAQVVYYIYAWLR 238 Query: 241 LGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTLESGAYEMRGV 300 + R V F+VPTGNFGDIFAGY+A++MGLP+E+L++ATN+N+IL+R + G Y + V Sbjct: 239 VAEQGRKVVFSVPTGNFGDIFAGYMAQQMGLPVEKLLLATNENNILTRFINQGDYSVGTV 298 Query: 301 AQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKPLSAIRSEFSA 360 QT SPSMDIQ++SNFER LF +DAA V LK G + S++ L +R +F + Sbjct: 299 VQTLSPSMDIQVASNFERYLFYLFKQDAARVSAAFAQLKAEGKISFSQQELQQVRQDFRS 358 Query: 361 GRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAREKASGTAPMVVLATAHPAKFPDAVK 420 T TI GYLLDPH+A+GV+ A+E + P+V LATAHPAKF +AV Sbjct: 359 ASVDRQATLETIRQFKHDTGYLLDPHTAVGVRAAQELVTDDTPVVCLATAHPAKFGEAVV 418 Query: 421 AACGVEPQLPAWLCDL 436 A G +P + L Sbjct: 419 EATGDAVPVPPAIAQL 434 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 460 Length adjustment: 33 Effective length of query: 430 Effective length of database: 427 Effective search space: 183610 Effective search space used: 183610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_012470330.1 GLOV_RS11290 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.22076.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-96 310.0 0.0 1.3e-96 309.7 0.0 1.0 1 lcl|NCBI__GCF_000020385.1:WP_012470330.1 GLOV_RS11290 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020385.1:WP_012470330.1 GLOV_RS11290 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 309.7 0.0 1.3e-96 1.3e-96 11 334 .. 67 423 .. 59 428 .. 0.93 Alignments for each domain: == domain 1 score: 309.7 bits; conditional E-value: 1.3e-96 TIGR00260 11 tekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelgne..tvl 77 + +dl +l+ +s+++f p+++ v++ +y++elfhg tlaFKD++lqf+++l++++l + e t++ lcl|NCBI__GCF_000020385.1:WP_012470330.1 67 PATDLQALIDRSYATFSHPEVTPVVQKDGVYILELFHGVTLAFKDVALQFLGNLFEYILHERHErlTIV 135 46899*******************************************************999999*** PP TIGR00260 78 cAtsGdtgaaaaealagkanvkvvvLyPkgkispv.keklvtalaenakvlaikGdFDdaqdlvkeife 145 +AtsGdtg+aa+++ +gka++++++L P+gk+spv + +++ +l+en++ +a++G+FDd+qd+vk +++ lcl|NCBI__GCF_000020385.1:WP_012470330.1 136 GATSGDTGSAAIHGVRGKAGISIFILHPHGKTSPVqALQMTSVLDENVHNIAVDGTFDDCQDIVKGLMG 204 ********************************************************************9 PP TIGR00260 146 ...dkeklklnsvNsinparieaqk.tyafeiveqlgkespdkvvvpvpsgnfgailkGflekkelglp 210 k+k+ l++vNsin+ar++aq+ +y++ + + + kvv++vp gnfg+i++G+++ +++ lp lcl|NCBI__GCF_000020385.1:WP_012470330.1 205 dleFKQKYSLGAVNSINWARVLAQVvYYIYAWLRVAE--QGRKVVFSVPTGNFGDIFAGYMAQQMG-LP 270 543455*******************999999988776..8899*****************999999.** PP TIGR00260 211 ieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnverale.larrslgnledlke.... 274 +ekl a++++ +i++rf+++gd + + ++Tls++mdi sn+er l+ l+++ + + + + lcl|NCBI__GCF_000020385.1:WP_012470330.1 271 VEKLLLATNEN-NILTRFINQGDYSVGTVVQTLSPSMDIQVASNFERYLFyLFKQDAARVSAAFAqlka 338 **********9.**********99999999*******************99888887777666556777 PP TIGR00260 275 .....................svsdeeileaikklaeeegyllephtavavaalkklvekg..vs..at 318 sv +++le+i++ + gyll+phtav+v+a ++lv ++ v at lcl|NCBI__GCF_000020385.1:WP_012470330.1 339 egkisfsqqelqqvrqdfrsaSVDRQATLETIRQFKHDTGYLLDPHTAVGVRAAQELVTDDtpVVclAT 407 ********************999999*********************************99773368** PP TIGR00260 319 adpaKFeevvealtgn 334 a+paKF e+v+ tg lcl|NCBI__GCF_000020385.1:WP_012470330.1 408 AHPAKFGEAVVEATGD 423 **********988876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (460 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 14.13 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory