Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_012471182.1 GLOV_RS15585 acetylglutamate kinase
Query= BRENDA::Q9HTN2 (301 letters) >NCBI__GCF_000020385.1:WP_012471182.1 Length = 292 Score = 324 bits (830), Expect = 2e-93 Identities = 166/285 (58%), Positives = 211/285 (74%), Gaps = 1/285 (0%) Query: 12 AKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGGGPQ 71 A L EALPYIRRF G+T VIKYGG+AM E LK FA DV+++K++GIN V+VHGGGPQ Sbjct: 8 ANTLMEALPYIRRFSGRTFVIKYGGHAMSDERLKESFALDVIMLKSLGINAVIVHGGGPQ 67 Query: 72 IGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTGKDA 131 I + LKR I S F+ GMRVTD TM VVEMVL GQVNK++V +N+HGG A+GL GKD Sbjct: 68 INETLKRYGIVSEFVRGMRVTDGETMSVVEMVLVGQVNKEVVGYLNQHGGKAVGLCGKDG 127 Query: 132 ELIRAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGVGSNG 191 L+ +KKL + T E E IDIG+VG+V VN L+ L +G ++PVIAP+GVG G Sbjct: 128 SLLLSKKL-LQEVTGEDGAIEQIDIGYVGDVVKVNTDLIKTLEQGGYLPVIAPVGVGLAG 186 Query: 192 ESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGTIYGG 251 ESYNINAD+VAG+VA AL AEKL+LLT+ G++DK Q++ +S Q++ LI D +I GG Sbjct: 187 ESYNINADVVAGRVAAALNAEKLILLTDTPGVLDKDKQLIQKISVAQMHRLIEDESITGG 246 Query: 252 MLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLIS 296 M+PK+ C EA+ GV AHIIDGR+ ++VLLEIFTD G+GT I+ Sbjct: 247 MIPKVVCCAEALNDGVKKAHIIDGRMEHSVLLEIFTDVGIGTEIT 291 Lambda K H 0.318 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 292 Length adjustment: 26 Effective length of query: 275 Effective length of database: 266 Effective search space: 73150 Effective search space used: 73150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_012471182.1 GLOV_RS15585 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.46151.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-84 268.4 6.7 3e-84 268.2 6.7 1.0 1 NCBI__GCF_000020385.1:WP_012471182.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000020385.1:WP_012471182.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 268.2 6.7 3e-84 3e-84 1 231 [] 25 267 .. 25 267 .. 0.98 Alignments for each domain: == domain 1 score: 268.2 bits; conditional E-value: 3e-84 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketlevve 71 t ViK+GG+a+s +l+e++a d++ l++ gi+ vivHGGgp+ine l++ gi efv g+RvTd et+ vve NCBI__GCF_000020385.1:WP_012471182.1 25 TFVIKYGGHAMSdeRLKESFALDVIMLKSLGINAVIVHGGGPQINETLKRYGIVSEFVRGMRVTDGETMSVVE 97 57**********999********************************************************** PP TIGR00761 72 mvligkvnkelvallekhgikavGltgkDgqlltaekldke...........dlgyvGeikkvnkelleallk 133 mvl+g+vnke+v l++hg kavGl+gkDg+ll +kl +e d+gyvG++ kvn++l+++l + NCBI__GCF_000020385.1:WP_012471182.1 98 MVLVGQVNKEVVGYLNQHGGKAVGLCGKDGSLLLSKKLLQEvtgedgaieqiDIGYVGDVVKVNTDLIKTLEQ 170 ************************************999989999**************************** PP TIGR00761 134 agiipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGilegdkksliseleleeieqlikqav 206 g++pvia++++ +g+ +N+naD++A+ +Aaal+AekL+lLtd++G+l++dk+ li++++++++++li+ + NCBI__GCF_000020385.1:WP_012471182.1 171 GGYLPVIAPVGVGLAGESYNINADVVAGRVAAALNAEKLILLTDTPGVLDKDKQ-LIQKISVAQMHRLIEDES 242 ***************************************************888.****************** PP TIGR00761 207 ikgGmipKveaalealesgvkkvvi 231 i+gGmipKv +++eal++gvkk++i NCBI__GCF_000020385.1:WP_012471182.1 243 ITGGMIPKVVCCAEALNDGVKKAHI 267 ***********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.03 # Mc/sec: 2.12 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory