Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate WP_012471196.1 GLOV_RS15655 3-isopropylmalate dehydratase small subunit
Query= curated2:Q65GJ1 (199 letters) >NCBI__GCF_000020385.1:WP_012471196.1 Length = 175 Score = 105 bits (261), Expect = 6e-28 Identities = 64/172 (37%), Positives = 93/172 (54%), Gaps = 10/172 (5%) Query: 4 LKTHNGIAAVLNRINVDTDQIIPKQFLKRIERTGYGRFAFFDWRYLDNGDPNPDFELNRP 63 +KT G L+R +++TD+IIP ++L I + + D + LD DP + L Sbjct: 1 MKTFGGPVLFLDRADINTDEIIPAKYLTEITKQDLKPYMLEDLK-LDGFDPKGEKTLK-- 57 Query: 64 EYKGASILIAGENFGCGSSREHAPWALDDYGFKIIIAPSFADIFHQNCFKNGMLPIRLPY 123 A ++++ ENFGCGSSREHAPW + ++A SFA IF QN F GM I LP Sbjct: 58 ----ARVVVSRENFGCGSSREHAPWVFEVNNITAVVAESFARIFRQNMFNCGMAAIELPK 113 Query: 124 EAWKELAEQYEYQSLTMTVDLEKQTITDHA-GRQIA--FEVDPHWKEMLLNG 172 + + TM++D+E QT+T A G Q+A FE+ P K ++L G Sbjct: 114 TDLDRIFSHAQDADATMSIDIEAQTLTLSAGGTQLAFNFELSPFDKALVLAG 165 Lambda K H 0.320 0.139 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 103 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 199 Length of database: 175 Length adjustment: 20 Effective length of query: 179 Effective length of database: 155 Effective search space: 27745 Effective search space used: 27745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory