Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate WP_012473666.1 CPHAMN1_RS01040 glutamate-1-semialdehyde 2,1-aminomutase
Query= metacyc::MONOMER-18314 (387 letters) >NCBI__GCF_000020545.1:WP_012473666.1 Length = 431 Score = 147 bits (370), Expect = 7e-40 Identities = 102/316 (32%), Positives = 154/316 (48%), Gaps = 45/316 (14%) Query: 8 GDRGLTIVKGEAQYVWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLENISILSTSF 67 G + + KG+ Y+ D++G YLD+ G LG +P I ++N L I TSF Sbjct: 33 GGTPIFMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRITAAIENTLTKIG---TSF 89 Query: 68 STPIKDEM--LQALDKVKPDKMDNAMLLNSGTEAVEAALKTARKITGRKKIIAFKNAFHG 125 TPI+ E+ + L ++ P ++ ++NSGTEA +A++ AR TGR KII F+ +HG Sbjct: 90 GTPIEMEIEIAELLTQIVPS-IEMVRMVNSGTEATMSAVRLARGYTGRDKIIKFEGCYHG 148 Query: 126 R-----------------------TAGSLSVTWNKKYREPFEPLVGPVEFLTFNNIEDLS 162 T G+ + T N KY + + V L N + + Sbjct: 149 HGDSFLIKAGSGALTLGAPDSPGVTKGTANDTLNAKYND-----IESVRVLVKENKDSI- 202 Query: 163 KIDNETAAVIVEPIQGESGVIPANIEFMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAY 222 AA+I+EP+ G +GVIPA +F++AL++ G +LIFDE+ GF R A Sbjct: 203 ------AAIIIEPVAGNTGVIPAKTDFLQALRDLCTEEGIVLIFDEVMCGF-RVALGGAQ 255 Query: 223 KHYNIVPDILTAGKAIGGGFPVSVVFLPDHIANKLEE-GD--HGSTYGGNPMAMAAVTAA 279 + Y I PD+ T GK IGGG PV I ++ GD T GNP+A+ A Sbjct: 256 ERYGITPDLTTMGKIIGGGLPVGAFGGKREIMQRVAPIGDVYQAGTLSGNPLALTAGLET 315 Query: 280 CKVIEKENVVEQANQK 295 K++ +N + +K Sbjct: 316 LKILRDDNPYPELERK 331 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 431 Length adjustment: 31 Effective length of query: 356 Effective length of database: 400 Effective search space: 142400 Effective search space used: 142400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory