Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate WP_012474327.1 CPHAMN1_RS04460 glutamate 5-kinase
Query= reanno::Pedo557:CA265_RS20855 (359 letters) >NCBI__GCF_000020545.1:WP_012474327.1 Length = 361 Score = 356 bits (913), Expect = e-103 Identities = 175/353 (49%), Positives = 252/353 (71%), Gaps = 1/353 (0%) Query: 5 YKKIVVKVGSNVITQANGLPDEGRIKHLVNQLADIKKQGIEVILVSSGAVASGRSLIKVS 64 Y+KIV+KVG+NVIT G D ++ LV+Q+++++ +G+EV LVSSGAVA+GR+ + ++ Sbjct: 6 YQKIVIKVGTNVITDNRGELDLQILEELVSQISELRSRGVEVFLVSSGAVAAGRAKVTLN 65 Query: 65 EKQDAVTTRQLLAAIGQVKLINTYANFFAAHAIQCAQVLVTKEDFRDRAHYLNMKNCLQI 124 E + RQ+L++ GQ++LINTY + F HA++ AQ+LVTK DFRDR HYLN++ CL+ Sbjct: 66 EDLSPIAARQVLSSTGQIRLINTYTDLFEKHALKIAQILVTKSDFRDRQHYLNIRTCLES 125 Query: 125 LLQNEVIPVVNENDVVSVTELMFTDNDELAGLIASMLNADALIILSNVNGIYNGDPKVEG 184 L++ ++IPV+NEND VSVTELMFTDNDEL+GLIASM++ DA IILS+++G+++ + Sbjct: 126 LMKYDIIPVINENDAVSVTELMFTDNDELSGLIASMMHVDAYIILSHIDGLFDLSGDEKP 185 Query: 185 SAVIEEINGSVANLASFIQTGKSQFGRGGMITKSTMAQKVAKLGITVHIANGTKDNVLTS 244 +I ++ + + +I+ GKS+FGRGGM+TK +AQK+++ GI VHIANG +L Sbjct: 186 PRLITSVDIATEHFHQYIKPGKSEFGRGGMLTKCHIAQKLSRFGIAVHIANGQTPGILLD 245 Query: 245 LLNNELVHTRFVPEKSKSGKKKWIAHSETAATGVVKLNDGAKTVLTS-SKATSLLPVGII 303 LL+ + TRFVP+K G+K+WIAHSE G V +N GA+ L S +A SLLPVGI Sbjct: 246 LLDGKAAGTRFVPQKPVYGRKRWIAHSEGLEKGAVTINTGAEKALRSQERANSLLPVGIE 305 Query: 304 EIQTDFLKGDIIKIVDEKNNLIGLGIAEYGSDKARERIGQKKQKALVHYDYFY 356 + F KGDII+I E IG G+A Y S++ +E +G+K K L+HYDY Y Sbjct: 306 SVLGAFYKGDIIRICSENEETIGYGMARYSSEETKELMGKKGAKPLIHYDYLY 358 Lambda K H 0.316 0.133 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 361 Length adjustment: 29 Effective length of query: 330 Effective length of database: 332 Effective search space: 109560 Effective search space used: 109560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_012474327.1 CPHAMN1_RS04460 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.19545.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-100 321.1 0.0 5.8e-100 320.9 0.0 1.0 1 lcl|NCBI__GCF_000020545.1:WP_012474327.1 CPHAMN1_RS04460 glutamate 5-kina Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020545.1:WP_012474327.1 CPHAMN1_RS04460 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 320.9 0.0 5.8e-100 5.8e-100 1 340 [. 7 347 .. 7 357 .. 0.96 Alignments for each domain: == domain 1 score: 320.9 bits; conditional E-value: 5.8e-100 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQ 69 ++iV+K+G++++t++ g+l++++l+elv+q+++l++ G ev +vsSGavaaG ++ l+e +a +Q lcl|NCBI__GCF_000020545.1:WP_012474327.1 7 QKIVIKVGTNVITDNRGELDLQILEELVSQISELRSRGVEVFLVSSGAVAAGRAKVTLNEDLSPIAARQ 75 68******************************************************************* PP TIGR01027 70 alaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvave 138 +l++ GQ rL+++y++lf+++ lk+aQiL t++d+++r++ylN r+ le+l++ +++p++NEND+v+v+ lcl|NCBI__GCF_000020545.1:WP_012474327.1 76 VLSSTGQIRLINTYTDLFEKHALKIAQILVTKSDFRDRQHYLNIRTCLESLMKYDIIPVINENDAVSVT 144 ********************************************************************* PP TIGR01027 139 eikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGT 207 e+ f DND+Ls l+a++++ d+ ++l+ +dgL+d ++p +li v+ ++e+++++ + s++G lcl|NCBI__GCF_000020545.1:WP_012474327.1 145 ELMFTDNDELSGLIASMMHVDAYIILSHIDGLFDLSGDEKP-PRLITSVDIATEHFHQYIKPGKSEFGR 212 ************************************97777.59***********99999888899*** PP TIGR01027 208 GGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeakkkklknrkqwilaase.akGki 275 GGm tK + a+ sr g+ v ia+g++p ++dll+++a gt f ++k + rk+wi++ + +kG++ lcl|NCBI__GCF_000020545.1:WP_012474327.1 213 GGMLTKCHIAQKLSRFGIAVHIANGQTPGILLDLLDGKAAGTRFVPQKP-VYGRKRWIAHSEGlEKGAV 280 **********************************************976.999******9875278*** PP TIGR01027 276 ivdegaeeallekgks..LlpagvvevegnFsrgevveilaeegqeigkglvnysseelekikglks 340 +++ gae+al++++++ Llp+g+ +v g F +g++++i++e+ ++ig g+++yssee ++++g+k lcl|NCBI__GCF_000020545.1:WP_012474327.1 281 TINTGAEKALRSQERAnsLLPVGIESVLGAFYKGDIIRICSENEETIGYGMARYSSEETKELMGKKG 347 **********98875444**********************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (361 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.02 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory