Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_012474341.1 CPHAMN1_RS04525 triose-phosphate isomerase
Query= SwissProt::Q8XKU1 (248 letters) >NCBI__GCF_000020545.1:WP_012474341.1 Length = 250 Score = 236 bits (603), Expect = 2e-67 Identities = 117/249 (46%), Positives = 166/249 (66%), Gaps = 4/249 (1%) Query: 1 MRTPIIAGNWKMHYTIDEAVKLVEELKPLVKDAK--CEVVVCPTFVCLDAVKKAVEGTNI 58 MR I+ GNWKM+ + E V L + + K CEV + P + L V + +EG++I Sbjct: 1 MRKKIVVGNWKMNKNVAEGVALASSILENLDGGKMACEVGIAPAYPVLSEVGRVIEGSDI 60 Query: 59 KVGAQNMHFEEKGAFTGEIAPRMLEAMNIDYVIIGHSERREYFNETDETCNKKVKAAFAH 118 + AQN H+E++GA+TGE++ RML+++ Y+I+GHSERR+YF ET+ T N ++K A Sbjct: 61 CLVAQNCHYEDEGAYTGEVSVRMLDSLGCSYIIVGHSERRQYFGETNRTVNLRLKKALEG 120 Query: 119 NLTPILCCGETLEQRENGTTNDVIKAQITADLEGLTKEQAEKVVIAYEPIWAIGTGKTAT 178 + ILC GETLE+RE G T+ ++ AQ+ L + E VV+AYEP+WAIGTGKTAT Sbjct: 121 GMRVILCIGETLEEREAGVTDAIVTAQVREGLADI--EDLGNVVLAYEPVWAIGTGKTAT 178 Query: 179 SDQANETIAAIRAMVAEMFGQEVADKVRIQYGGSVKPNTIAEQMAKSDIDGALVGGASLV 238 +QA+ A+IRA +++M+G+ A+ +RIQYGGSVKP+ E +IDG L+GGASL Sbjct: 179 PEQADAVHASIRATISDMYGEADAEDIRIQYGGSVKPSNAVELFGMPNIDGGLIGGASLK 238 Query: 239 AADFAQIVN 247 A DF IVN Sbjct: 239 ADDFVAIVN 247 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 250 Length adjustment: 24 Effective length of query: 224 Effective length of database: 226 Effective search space: 50624 Effective search space used: 50624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
Align candidate WP_012474341.1 CPHAMN1_RS04525 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00419.hmm # target sequence database: /tmp/gapView.28514.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-65 205.1 0.9 7.7e-65 204.9 0.9 1.0 1 lcl|NCBI__GCF_000020545.1:WP_012474341.1 CPHAMN1_RS04525 triose-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020545.1:WP_012474341.1 CPHAMN1_RS04525 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 204.9 0.9 7.7e-65 7.7e-65 1 228 [] 5 240 .. 5 240 .. 0.93 Alignments for each domain: == domain 1 score: 204.9 bits; conditional E-value: 7.7e-65 TIGR00419 1 lviinfKlnesvgkvelevaklaeeva.seagvevavappfvdldvvkdeve.seiqvaAqnvdavksG 67 +v++n+K+n v + + +++ e++ ++ +ev++ap + l+ v + +e s+i ++Aqn++ + G lcl|NCBI__GCF_000020545.1:WP_012474341.1 5 IVVGNWKMNKNVAEGVALASSILENLDgGKMACEVGIAPAYPVLSEVGRVIEgSDICLVAQNCHYEDEG 73 79**********************99626889************************************* PP TIGR00419 68 aftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartin 136 a+tGe+s ml lG+ ++++gHsErR ++ e++ ++ ++ ++ e g+++++C+getleerea+ t lcl|NCBI__GCF_000020545.1:WP_012474341.1 74 AYTGEVSVRMLDSLGCSYIIVGHSERRQYFGETNRTVNLRLKKALEGGMRVILCIGETLEEREAGVTDA 142 ***************************************************************999865 PP TIGR00419 137 nvatt.aaaaA....lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskev.aesvrvlyGa 199 v+ + ++ A l ++v+A+EPv++iGtGk++++ +a++v++s+r ++ e ae++r++yG+ lcl|NCBI__GCF_000020545.1:WP_012474341.1 143 IVTAQvREGLAdiedLGNVVLAYEPVWAIGTGKTATPEQADAVHASIRATISDMYGEAdAEDIRIQYGG 211 555442344557889************************************9965554389******** PP TIGR00419 200 svtaaedaelaaqldvdGvLlasavlkae 228 sv+ ++++el+ +++dG L+++a+lka+ lcl|NCBI__GCF_000020545.1:WP_012474341.1 212 SVKPSNAVELFGMPNIDGGLIGGASLKAD 240 ***************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (250 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.62 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory