Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_012474362.1 CPHAMN1_RS04615 histidinol-phosphatase
Query= curated2:P56160 (259 letters) >NCBI__GCF_000020545.1:WP_012474362.1 Length = 252 Score = 362 bits (928), Expect = e-105 Identities = 177/249 (71%), Positives = 206/249 (82%), Gaps = 1/249 (0%) Query: 1 MTPDLQLALELAEKAGKLTLDYFGRRSLQVFSKRDDTPVTEADRNAEELIRQGISAKFPD 60 MT D+QLA++LA AG L L Y+ +SL++ SKRDDTPVTEADR AE LIR+GI+ FPD Sbjct: 1 MTDDMQLAVKLARDAGTLILSYYRSKSLKIDSKRDDTPVTEADRKAESLIRKGITEVFPD 60 Query: 61 DGLFGEEFDEHPSGNGRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALG 120 DG+FGEEFDE S NGRRWI+DPIDGTRSFIHGVPL+GVMI LEV+ M++G +NFPALG Sbjct: 61 DGIFGEEFDEKLSVNGRRWILDPIDGTRSFIHGVPLFGVMIGLEVDREMRVGAVNFPALG 120 Query: 121 ELYQAERGSGAFMNGSPVQVSAIAENSASTVVFTEKEYLLDPPSNHPVDQLRIDAGLVRG 180 E+Y AE GSGAF NG + VSAI++ +TVVFTEKEYLLDP S+HPVD LR DAGLVRG Sbjct: 121 EIYYAETGSGAFFNGEAISVSAISDYREATVVFTEKEYLLDPLSDHPVDSLRHDAGLVRG 180 Query: 181 WGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEGLVSA 240 WGDCYGHMLVASGRAEVAVDKIMSPWDCAA+IP+V EAGG CFDY G ++ I G+GLVS Sbjct: 181 WGDCYGHMLVASGRAEVAVDKIMSPWDCAALIPVVTEAGGRCFDYTG-ETTIYGQGLVST 239 Query: 241 NNAMGRNLI 249 N +G L+ Sbjct: 240 NRFIGDKLL 248 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 252 Length adjustment: 24 Effective length of query: 235 Effective length of database: 228 Effective search space: 53580 Effective search space used: 53580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_012474362.1 CPHAMN1_RS04615 (histidinol-phosphatase)
to HMM TIGR02067 (hisN: histidinol-phosphatase (EC 3.1.3.15))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02067.hmm # target sequence database: /tmp/gapView.24063.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02067 [M=252] Accession: TIGR02067 Description: his_9_HisN: histidinol-phosphatase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-89 285.2 0.0 2.6e-89 285.0 0.0 1.0 1 lcl|NCBI__GCF_000020545.1:WP_012474362.1 CPHAMN1_RS04615 histidinol-phosp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020545.1:WP_012474362.1 CPHAMN1_RS04615 histidinol-phosphatase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 285.0 0.0 2.6e-89 2.6e-89 2 248 .. 5 248 .. 4 252 .] 0.97 Alignments for each domain: == domain 1 score: 285.0 bits; conditional E-value: 2.6e-89 TIGR02067 2 lalalelaeaageailkyfrasdlkvdkksdktpVteADraaEeaireliaakfPddgilGEEfgeeee 70 ++la +la+ ag il+y+r ++lk d+k+d+tpVteADr+aE++ir+ i++ fPddgi+GEEf+e+ + lcl|NCBI__GCF_000020545.1:WP_012474362.1 5 MQLAVKLARDAGTLILSYYRSKSLKIDSKRDDTPVTEADRKAESLIRKGITEVFPDDGIFGEEFDEKLS 73 6899***************************************************************** PP TIGR02067 71 daeyvWvlDPiDGTksFirGvPvwgtLiaLlekgkpvlGvisqPalgerfvaakgegallnggerelrv 139 ++++W+lDPiDGT+sFi+GvP++g++i+L+ + ++ +G +++Palge+++a++g+ga+ ng + ++v lcl|NCBI__GCF_000020545.1:WP_012474362.1 74 VNGRRWILDPIDGTRSFIHGVPLFGVMIGLEVDREMRVGAVNFPALGEIYYAETGSGAFFNG--EAISV 140 *************************************************************7..8**** PP TIGR02067 140 sevaklsdAvlvttspkaledeeereafeklrrkarltryggdcyayalvAsGrvdlvveaelspyDia 208 s++++ +A++v+t++++l d+ + + +++lr++a l+r++gdcy+++lvAsGr++++v++++sp+D+a lcl|NCBI__GCF_000020545.1:WP_012474362.1 141 SAISDYREATVVFTEKEYLLDPLSDHPVDSLRHDAGLVRGWGDCYGHMLVASGRAEVAVDKIMSPWDCA 209 ********************************************************************* PP TIGR02067 209 alipiieeAggvitdwkGkeaeeggeavaaanaalhdevl 248 alip+++eAgg ++d++G+++ g +++n+ + d++l lcl|NCBI__GCF_000020545.1:WP_012474362.1 210 ALIPVVTEAGGRCFDYTGETTIYGQGL-VSTNRFIGDKLL 248 ******************998876555.999999998877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (252 nodes) Target sequences: 1 (252 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.81 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory