Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_012474521.1 CPHAMN1_RS05465 histidinol-phosphate transaminase
Query= curated2:Q3ARM7 (363 letters) >NCBI__GCF_000020545.1:WP_012474521.1 Length = 365 Score = 421 bits (1082), Expect = e-122 Identities = 212/343 (61%), Positives = 261/343 (76%) Query: 10 LLNPALRNIATYKVEGGQQAEIKLNQNESPFDVPQWLKEEIIGEFIREPWNRYPDILPYR 69 +LNPAL+ I Y VEGGQ AEIKLNQNESPFD+P+ LK+ I+ EF +E WNRYPDILPYR Sbjct: 18 MLNPALQRIGAYSVEGGQSAEIKLNQNESPFDLPEGLKDAILDEFKQESWNRYPDILPYR 77 Query: 70 AMEAYANFVGVPAECVIMSNGSNEMLYTIFLACLGPGRKVLIPNPSFSLYEKLALLLQSD 129 ++AYA F GV E V+MSNGSNEMLYTIF+ACL G ++++P PSFSLY+KLA++LQ++ Sbjct: 78 GIQAYAEFTGVSPESVMMSNGSNEMLYTIFIACLEKGSRIVLPEPSFSLYDKLAIMLQAE 137 Query: 130 IVEVPMKSDLSFDVEAIMKAAHNEAVDVIVLSNPNNPTSTSMSYDAVRKIAESTQALVLV 189 + VPM DL FDV I++ A E IVLS PNNPT S+S + +R I A+VLV Sbjct: 138 RIIVPMHDDLGFDVPEIIRRAQEERAAFIVLSTPNNPTGKSLSIEDIRMIVHEVDAIVLV 197 Query: 190 DEAYIEFSRERSMVDTIEELPNVVVLRTMSKALALAGIRIGFALANAPLMAEISKPKIPF 249 DEAY+EFSRE S + I+E PN++VLRTMSKALALAG+RIGFAL N L+AEI+KPKIPF Sbjct: 198 DEAYVEFSREDSALCLIDEAPNLIVLRTMSKALALAGMRIGFALTNPALLAEIAKPKIPF 257 Query: 250 ASSRLAEITLMKVLANYRLVDEAVSAILSERDALYEQLRMMEGVSPFASDTNFLIVRVAD 309 SSRLAEITL VLANY LV+E+VS IL ER+ +YE L+ + G+ F SD NF+I+RV + Sbjct: 258 TSSRLAEITLQHVLANYHLVEESVSYILQERERIYEALKGISGLHVFESDANFIIIRVRN 317 Query: 310 ANATFKRLYDKGILVRNVSGYHLMEGCLRCNVGLPEENRRLAE 352 A F L +GILVRNVSGY LM+ CLR N+GL +EN L E Sbjct: 318 AQEVFSFLAGEGILVRNVSGYPLMQNCLRFNIGLRKENDLLLE 360 Lambda K H 0.319 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 365 Length adjustment: 29 Effective length of query: 334 Effective length of database: 336 Effective search space: 112224 Effective search space used: 112224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_012474521.1 CPHAMN1_RS05465 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.27376.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-95 305.6 0.0 2.2e-95 305.4 0.0 1.0 1 lcl|NCBI__GCF_000020545.1:WP_012474521.1 CPHAMN1_RS05465 histidinol-phosp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020545.1:WP_012474521.1 CPHAMN1_RS05465 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 305.4 0.0 2.2e-95 2.2e-95 4 347 .. 23 363 .. 20 365 .] 0.96 Alignments for each domain: == domain 1 score: 305.4 bits; conditional E-value: 2.2e-95 TIGR01141 4 ikklepYqpgarelgekevvkLnsnEnPfgpsekvkealkeelk..klhrYpdpqalelkealakylgv 70 ++ + +Y+ e g+++ +kLn nE+Pf+ +e +k+a+ +e k + +rYpd +++ +a+a+++gv lcl|NCBI__GCF_000020545.1:WP_012474521.1 23 LQRIGAYSV---EGGQSAEIKLNQNESPFDLPEGLKDAILDEFKqeSWNRYPDILPYRGIQAYAEFTGV 88 566667777...5677799**********************999889********************** PP TIGR01141 71 eeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplked.gqedleavle 138 ++e+++++nGs+e++ +++ a+le+g +++ +ep++s+Y a + +ae + vp+++d g++ e + lcl|NCBI__GCF_000020545.1:WP_012474521.1 89 SPESVMMSNGSNEMLYTIFIACLEKGSRIVLPEPSFSLYDKLAIMLQAERIIVPMHDDlGFDVPEIIRR 157 **********************************************************76666666777 PP TIGR01141 139 aakekvklvflasPnnPtGnllkreeiekvleevedalVVvDeAYieFseeasvlellaeypnlvvlrT 207 a++e++ + l +PnnPtG++l+ e+i+ +++ev da+V+vDeAY+eFs+e s+l l+ e pnl+vlrT lcl|NCBI__GCF_000020545.1:WP_012474521.1 158 AQEERAAFIVLSTPNNPTGKSLSIEDIRMIVHEV-DAIVLVDEAYVEFSREDSALCLIDEAPNLIVLRT 225 *********************************9.9********************************* PP TIGR01141 208 lSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveevkkererllee 276 +SKa +LAg+R+G+a+ n+++ +++k + p+ s+la + l + + +e++v + +erer++e+ lcl|NCBI__GCF_000020545.1:WP_012474521.1 226 MSKALALAGMRIGFALTNPALLAEIAKPKIPFTSSRLAEITLQHVLANYHLVEESVSYILQERERIYEA 294 ********************************************************************* PP TIGR01141 277 lkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGtreenerllea 345 lk ++gl+v+eS+aNF++i+v+ +a+e++ l +gi+vR+++ + +l+++clR +G r+en+ lle lcl|NCBI__GCF_000020545.1:WP_012474521.1 295 LKGISGLHVFESDANFIIIRVR-NAQEVFSFLAGEGILVRNVSGY-PLMQNCLRFNIGLRKENDLLLEK 361 *********************9.**********************.588*******************9 PP TIGR01141 346 lk 347 l+ lcl|NCBI__GCF_000020545.1:WP_012474521.1 362 LR 363 97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 9.54 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory