Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_012474535.1 CPHAMN1_RS05530 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000020545.1:WP_012474535.1 Length = 402 Score = 224 bits (570), Expect = 4e-63 Identities = 131/390 (33%), Positives = 209/390 (53%), Gaps = 12/390 (3%) Query: 3 LAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHG 62 L + + + + AK+++A+GK ++ L G+PDF TP V +A +A+ G Sbjct: 12 LTRRVLSMQESQTMKITGLAKQMKAEGKDVVSLSAGEPDFPTPDFVAEAGIEAIRSGFTR 71 Query: 63 YVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTP 122 Y + GI E + A+ K K+ D +++++ GGK T+ A+ + G E+I P P Sbjct: 72 YTANAGIPELKAAIIEKFKRDNGIDFSQKQIIVSNGGKQTLANALLALCQEGDEVIIPAP 131 Query: 123 AFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEK 182 + + M+ G+ PV T D K PE++ S ITDKT++LIL +P+NP+G+ + Sbjct: 132 FWVSFPEMVRLAGAEPVIVSTTLDSGYKMSPEQLESAITDKTKVLILNSPSNPSGAVYAE 191 Query: 183 SAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNYPDLQDRLIVLDGWSKAYAMT 242 + L L + +LSDE+Y + +Y K+ + P ++D +IV +G SK Y+MT Sbjct: 192 EEVRALMAVLDGR-EIFVLSDEMYDQIVYGEKKPFSPARIPGMRDWVIVSNGVSKTYSMT 250 Query: 243 GWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRKL 302 GWR+G+ PE LI K+ + S N+ +Q A +AAL G I E +F++RR Sbjct: 251 GWRIGYLAGPEWLIDACGKIQSQTTSNANSIAQKAALAALTGDQQVIKERTEEFERRRDY 310 Query: 303 IHEGLNSLPGVECSLPGGAFYAFPKV---IGTGMNGSEF------AKKCMHEAGVAIVPG 353 + + LN +PG+ +LP GAFY FP + +G NG E A+ + + VA VPG Sbjct: 311 MFKALNEIPGITTTLPDGAFYIFPSISGLLGKTFNGKEMKNSTDVAEYLLVDHFVATVPG 370 Query: 354 TAFGKTCQDYVRFSYAASQDNISNALENIK 383 AFG + +R SYAAS + A+ I+ Sbjct: 371 EAFG--APENLRLSYAASISELEEAVGRIR 398 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 402 Length adjustment: 31 Effective length of query: 356 Effective length of database: 371 Effective search space: 132076 Effective search space used: 132076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory