Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_012474535.1 CPHAMN1_RS05530 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000020545.1:WP_012474535.1 Length = 402 Score = 240 bits (612), Expect = 6e-68 Identities = 146/382 (38%), Positives = 226/382 (59%), Gaps = 19/382 (4%) Query: 8 KAREIEISGIRKFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGY 67 +++ ++I+G+ K + A+ +DV+SL+ G+PDF TP V A +AI T YT NAG Sbjct: 21 ESQTMKITGLAK--QMKAEGKDVVSLSAGEPDFPTPDFVAEAGIEAIRSGFTRYTANAGI 78 Query: 68 LELRQAVQLYMKKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYE 127 EL+ A+ K+ ++ ++ +II++ G Q + A + GDEVI+P P + + Sbjct: 79 PELKAAIIEKFKRDNGIDF-SQKQIIVSNGGKQTLANALLALCQEGDEVIIPAPFWVSFP 137 Query: 128 PIINLCGAKPVIVDTT-SHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSI 186 ++ L GA+PVIV TT G+K++ +E A+T TK ++L PSNP+G +EEE++++ Sbjct: 138 EMVRLAGAEPVIVSTTLDSGYKMSPEQLESAITDKTKVLILNSPSNPSGAVYAEEEVRAL 197 Query: 187 AALLKGRNVFVLSDEIYSELTY-DRPHYSIATY--LRDQTIVINGLSKSHSMTGWRIGFL 243 A+L GR +FVLSDE+Y ++ Y ++ +S A +RD IV NG+SK++SMTGWRIG+L Sbjct: 198 MAVLDGREIFVLSDEMYDQIVYGEKKPFSPARIPGMRDWVIVSNGVSKTYSMTGWRIGYL 257 Query: 244 FAPKDIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYDRLVS 303 P+ + K+ S A+SI+QKAAL A+T E++++R DY++ L Sbjct: 258 AGPEWLIDACGKIQSQTTSNANSIAQKAALAALTGDQQVIKERTEEFERRRDYMFKALNE 317 Query: 304 M-GLDVVKPSGAFYIFPSI-----KSFG----MTSFDFSMALLEDAGVALVPGSSFSTYG 353 + G+ P GAFYIFPSI K+F S D + LL D VA VPG +F Sbjct: 318 IPGITTTLPDGAFYIFPSISGLLGKTFNGKEMKNSTDVAEYLLVDHFVATVPGEAFG--A 375 Query: 354 EGYVRLSFACSMDTLREGLDRL 375 +RLS+A S+ L E + R+ Sbjct: 376 PENLRLSYAASISELEEAVGRI 397 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 402 Length adjustment: 31 Effective length of query: 362 Effective length of database: 371 Effective search space: 134302 Effective search space used: 134302 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory