Align Putative (R)-citramalate synthase CimA; EC 2.3.3.21 (uncharacterized)
to candidate WP_012475142.1 CPHAMN1_RS08710 homocitrate synthase
Query= curated2:O29305 (489 letters) >NCBI__GCF_000020545.1:WP_012475142.1 Length = 383 Score = 228 bits (582), Expect = 2e-64 Identities = 132/368 (35%), Positives = 209/368 (56%), Gaps = 4/368 (1%) Query: 5 ILDTTLRDGEQTPGVSLSVEQKVMIAEALDNLGVDIIEAGTAIASEGDFQAIKEISQRGL 64 I+DTTLRDGEQ PGV S E+K IA + ++G D +E G S + + I+EI L Sbjct: 9 IIDTTLRDGEQAPGVVFSPEEKKDIAAMIADIGADELEIGYPAISVDEQRVIREIVAMKL 68 Query: 65 NAEICSFARIKREDIDAAADAGAESIFMVAPSSDIHINAKFPGKDRDYVIEKSVEAIEYA 124 + ++R KR DI+ A+ E I + P S+++++ GKD +V E+ I A Sbjct: 69 PKRLTCWSRAKRSDIECASRCETEGIHISFPISNLYLDLM--GKDYLWVREQLEILIPEA 126 Query: 125 KERGLIVEFGAEDASRADLDFVIQLFKRAEEAKADRITFADTVGVLSPEKMEEIVRKIKA 184 K+ V GA+DA+R D+ + + A ADR+ ADTVG+ +P + + ++K+ Sbjct: 127 KKHFSFVSAGAQDATRTDVTTLEAFARDASLCGADRVRIADTVGIATPLTLMRHIEQLKS 186 Query: 185 KVKLPLAIHCHDDFGLATANTIFGIKAGAEEFHGTINGLGERAGNAAIEEVVIALEYLYG 244 V +PL H H+D G+ATAN I+AG + ++NGLGERAGNAA+EE+ +AL+ Sbjct: 187 SVTIPLEFHAHNDLGMATANAFSAIEAGCDAVSVSVNGLGERAGNAALEELSLALKLSGR 246 Query: 245 IKTKIKKERLYNTSKLVEKLSRVVVPPNKPIVGDNAFTHESGIHTSALFRDAKSYEPISP 304 + IK +RL+ + V K S ++ KP+ G F HESGIH +AL +D SY+P P Sbjct: 247 YRNSIKTDRLHRLCEKVAKASNRIIQDQKPVTGSAVFQHESGIHCNALLKDPLSYQPFLP 306 Query: 305 EVVGRKRV-IVLGKHAGRASVEAIMNELGYKATPEQMKEILARIKEIGDKGKR-VTDADV 362 +G++ +V+GKH+G AS++ M G E+ ++L ++ ++ K ++ A++ Sbjct: 307 GDIGKEAYELVIGKHSGSASIQHAMEANGISIDREEAGKMLLSVRLAANRKKSGLSSAEL 366 Query: 363 RTIIETVL 370 I + L Sbjct: 367 MNIYKECL 374 Lambda K H 0.317 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 489 Length of database: 383 Length adjustment: 32 Effective length of query: 457 Effective length of database: 351 Effective search space: 160407 Effective search space used: 160407 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory