Align Succinylornithine transaminase; SOAT; Succinylornithine aminotransferase; EC 2.6.1.81 (characterized)
to candidate WP_012501411.1 CPAR_RS00790 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::Q8ZPV2 (408 letters) >NCBI__GCF_000020505.1:WP_012501411.1 Length = 431 Score = 140 bits (353), Expect = 7e-38 Identities = 109/327 (33%), Positives = 151/327 (46%), Gaps = 34/327 (10%) Query: 22 PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRFWHIGNGYTNE 81 P +G+G+ + D G Y+D+ G LG HP L A+ E R G E Sbjct: 36 PIYMAKGQGAYMTDVDGNTYLDYVGSWGPFILGSMHPRLTAAI-EYTLRNIGTSFGTPIE 94 Query: 82 PALRLAKKLIDATFA-ERVFFCNSGAEANEAALKLARKYAHDRVGNHKSGIVAFKNAFHG 140 + +A+ L + E V NSG EA +A++LAR Y K I+ F+ +HG Sbjct: 95 IEIEIAELLCQIVPSLEMVRMVNSGTEATMSAVRLARGYTG------KDKIIKFEGCYHG 148 Query: 141 R-TLFTVSAG------GQPTYSQDFAPLPPDIRHAAYNDLNSASALIDDN---TCAVIVE 190 F + AG G P D +A YND+ S A++++N A+I+E Sbjct: 149 HGDSFLIKAGSGVLTLGDPDSPGVTKGTANDTLNATYNDIESVKAIVNENKGQVAAIIIE 208 Query: 191 PVQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTG----VGRTGELYAYMHYGVTPD 246 PV G GVIPA K FL LRELCD +LIFDEV G +G EL YGVTPD Sbjct: 209 PVAGNTGVIPAKKEFLVALRELCDAEGIVLIFDEVMCGFRVALGGAQEL-----YGVTPD 263 Query: 247 ILTTAKALGGGFPIGAMLTTQDYASVMTP-GT--HGTTYGGNPLATAVAGKVLDIINT-- 301 + T K +GGG P+GA + + P G+ T GNPLA + L I+ Sbjct: 264 LTTMGKIIGGGLPVGAFGGKRKIMENIAPLGSVYQAGTLSGNPLALTAGLETLKILMEEN 323 Query: 302 --PEMQNGVRQRHDAFIERLNTLNVRF 326 PE++ F + +N L + + Sbjct: 324 PYPELERKAAFLEAGFKDNMNKLGLNY 350 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 461 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 408 Length of database: 431 Length adjustment: 32 Effective length of query: 376 Effective length of database: 399 Effective search space: 150024 Effective search space used: 150024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory