Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_012501726.1 CPAR_RS02420 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
Query= BRENDA::P16250 (240 letters) >NCBI__GCF_000020505.1:WP_012501726.1 Length = 260 Score = 146 bits (368), Expect = 4e-40 Identities = 84/234 (35%), Positives = 131/234 (55%), Gaps = 6/234 (2%) Query: 6 LLPAVDVRDGQAVRLVHGESGTETSY-GSPLEAALAWQRSGAEWLHLVDLDAAFGTGD-- 62 ++PA+D+++G+ VRL G+ + Y +P + A+ W++ A+ LH+VDLDAA TG+ Sbjct: 3 IIPAIDIKEGKCVRLTRGDFAQKKIYLDNPADMAIIWRKQNAKMLHVVDLDAAL-TGEMV 61 Query: 63 NRALIAEVAQAMDIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHG 122 N I E+ + +DI +++ GGIR + + L+ G +RV +G+AA+ P VA ++ ++ Sbjct: 62 NFEKIREIVELLDIPIQVGGGIRSVEAVEKYLSIGVSRVVIGSAAVTNPSLVADLLKKYR 121 Query: 123 -DKIAVGLDVRGTTLRGRGWTRDGG-DLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLE 180 +I VG+D + +GWT YE + K G R + TDI +DG LQG E Sbjct: 122 PSQIVVGIDAEHGVPKIKGWTESSNMQDYELALEMKKLGVERIIYTDITRDGMLQGVGYE 181 Query: 181 LLKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEE 234 K + ASGGVS+ DDL + L GV+ I+GKALY F +E Sbjct: 182 TTKRFAEKAGMKITASGGVSTSDDLHKLRSLERFGVDSVIIGKALYECNFPCQE 235 Lambda K H 0.315 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 7 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 260 Length adjustment: 24 Effective length of query: 216 Effective length of database: 236 Effective search space: 50976 Effective search space used: 50976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory