Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate WP_012501735.1 CPAR_RS02465 aminodeoxychorismate synthase component I
Query= curated2:Q9Z4W7 (511 letters) >NCBI__GCF_000020505.1:WP_012501735.1 Length = 606 Score = 185 bits (469), Expect = 5e-51 Identities = 103/266 (38%), Positives = 151/266 (56%), Gaps = 1/266 (0%) Query: 235 GWTANLTEAQFTERVARAREHIAAGDAFQIVLSRRLSRPLRARPTDLYRHLRATNPSPYM 294 G+ EA++ +R+ R ++ IAAG+ +Q+ + R P LY ++ PSP+ Sbjct: 124 GFGFEFDEAEYCQRIDRLKDEIAAGNVYQVNFTGRCGFTFDGSPEALYVAMKRRQPSPWS 183 Query: 295 YHLSLGGGRHVIGASPELLVKAEGRTVRTRPLAGTRPRHPDPAEDLRLERELRADEKERA 354 L+ G R V+ SPEL EGR + T P+ GT PR ED L EK RA Sbjct: 184 AMLNTGD-RLVLSFSPELFFVREGRLIETMPMKGTAPRMTSAEEDRAAREGLAKCEKNRA 242 Query: 355 EHVMLVDLGRNDLGRVTEPGTVRVERLMRVERFSHVMHLSSTVRGRLAEGRDALDALRSA 414 E++M+VDL RNDLGR+ E G+V+ L + + + + ST+RG L + D R+ Sbjct: 243 ENLMIVDLLRNDLGRICETGSVQASDLFETQTYPTLHQMVSTIRGELRDETRLHDLFRAL 302 Query: 415 FPAGTLSGAPKIRAMEIIAELEPEQRGVYGGALGFVGADGLTDFAIALRTMVVADGHVHV 474 FP G+++GAPK+RAM++I ELE RGVY GA+GF+ G T F +A+RT+ + Sbjct: 303 FPCGSVTGAPKVRAMKLIRELERSPRGVYTGAVGFMLPGGRTAFNVAIRTIELQGRRGVY 362 Query: 475 QAGAGIVADSDPAAEFRETLHKSRAM 500 G+GIV DS+P EFRE + K+ + Sbjct: 363 GTGSGIVWDSEPQQEFRECMLKTEIL 388 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 603 Number of extensions: 36 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 511 Length of database: 606 Length adjustment: 36 Effective length of query: 475 Effective length of database: 570 Effective search space: 270750 Effective search space used: 270750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory