Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_012501773.1 CPAR_RS02655 indole-3-glycerol-phosphate synthase
Query= BRENDA::P00909 (453 letters) >NCBI__GCF_000020505.1:WP_012501773.1 Length = 256 Score = 138 bits (348), Expect = 2e-37 Identities = 89/249 (35%), Positives = 134/249 (53%), Gaps = 6/249 (2%) Query: 4 TVLAKIVADKAIWVEARKQQQPLASFQNEVQ--PSTRHFYDALQGARTAF--ILECKKAS 59 T L +I+ KA V K+Q P + P+TR F A+ I E KKAS Sbjct: 2 TYLTRILETKAEEVAELKKQDPERRYHEACGDLPATRDFRSAITSLDGGINLIAEVKKAS 61 Query: 60 PSKGVIRDDFDPARIAAIYKHY-ASAISVLTDEKYFQGSFNFLPIVSQIAPQPILCKDFI 118 PS+GV+ +DF P IA Y ASA SVLTD +YFQGS ++L ++Q P+L K+FI Sbjct: 62 PSRGVLVEDFRPLDIAERYAEIGASAFSVLTDRQYFQGSPDYLKAITQKFSIPVLRKEFI 121 Query: 119 IDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQERAIALG 178 ID QIY R ADA LL+++ L+ Q R + L + L E +E E + A+ G Sbjct: 122 IDESQIYETRLMGADAALLIVAALEPSQLRDYLQLFAELGLHALVETHDERELDTALEQG 181 Query: 179 AKVVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHFA-NGFLIG 237 + +VG+NNRDL+ ++DL + L ++ + ++ESG+ ++ + + LIG Sbjct: 182 STIVGVNNRDLKTFTVDLMTSVRLRQRMPDGIVSVAESGMKHRDDIQMMQEAGFDAVLIG 241 Query: 238 SALMAHDDL 246 L+ ++L Sbjct: 242 EGLLVSEEL 250 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 256 Length adjustment: 28 Effective length of query: 425 Effective length of database: 228 Effective search space: 96900 Effective search space used: 96900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory