Align Anthranilate phosphoribosyltransferase 2; EC 2.4.2.18 (characterized)
to candidate WP_012501830.1 CPAR_RS02930 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8YXQ9 (362 letters) >NCBI__GCF_000020505.1:WP_012501830.1 Length = 351 Score = 241 bits (614), Expect = 3e-68 Identities = 139/344 (40%), Positives = 200/344 (58%), Gaps = 17/344 (4%) Query: 18 LLQQLIDGESLSRSQAAELMQGWLSEAVPPELSGAILTALNFKGVSADELTGMAEVLQSQ 77 L+Q+L+ G LS + + + +GAIL L KGV+ E G E L ++ Sbjct: 6 LIQKLLAGADLSAQEMEACIDSIMENRFTDAGTGAILALLQKKGVTPTEAIGAYENLMTR 65 Query: 78 SKMGTGENYSQLPITNSPFSIIDTCGTGGDGSSTFNISTAVAFVAAAYGVPVAKHGNRSA 137 PIT P +DTCGTGGD TFNISTA AF+AA GVP+AKHGNRS Sbjct: 66 VT----------PIT-LPAHAVDTCGTGGDHRGTFNISTAAAFIAAGAGVPIAKHGNRSI 114 Query: 138 SSLTGSADVLEALGVNLGASPEKVQAALQEVGITFLFAPGWHPALKAVATLRRTLRIRTV 197 +S GSADVLEALG + + +E G FLFAP +HP++KAVA++RR L IRT+ Sbjct: 115 TSKCGSADVLEALGYRVDLPASATEEQFRETGFAFLFAPLYHPSMKAVASIRRELGIRTL 174 Query: 198 FNLLGPLVNPLRPTGQVVGLFTPKLLTTVAQALDNLGKQKAIVLHGR----ERLDEAGLG 253 FNLLGPL+NP + Q +G+F P ++ A L + G Q A+++HG+ + LDEA + Sbjct: 175 FNLLGPLINPAKVKRQFIGVFDPSVMELYADVLIHAGCQHAMIVHGKTEHGDGLDEASVS 234 Query: 254 DLTDLAVLSDGELQLTTINPQEVGVTPAPIGALRGGDVQENAEILKAVLQGKGTQAQQDA 313 T + L +G L T+NP++ G+ I L GGD + NA+I++ +L G TQAQ DA Sbjct: 235 GPTTIIELFEGRLCHHTVNPEDFGLNRWSIDELAGGDAETNAQIIRQILDGSATQAQIDA 294 Query: 314 VALNAALALQVAGAVPLLDHAQGVSVAKEILQTGTAWAKLAQLV 357 +A+ V+G +D +G+S++KE L++ A + +++ Sbjct: 295 ALFASAITCYVSGMGSCID--EGMSMSKESLESLAAMENMNRII 336 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 351 Length adjustment: 29 Effective length of query: 333 Effective length of database: 322 Effective search space: 107226 Effective search space used: 107226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate WP_012501830.1 CPAR_RS02930 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.28493.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-114 367.9 0.1 3e-114 367.7 0.1 1.0 1 lcl|NCBI__GCF_000020505.1:WP_012501830.1 CPAR_RS02930 anthranilate phosph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020505.1:WP_012501830.1 CPAR_RS02930 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 367.7 0.1 3e-114 3e-114 1 329 [. 7 337 .. 7 338 .. 0.98 Alignments for each domain: == domain 1 score: 367.7 bits; conditional E-value: 3e-114 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeese 69 ++kll + dLs++e+e+ ++ im+++++da +Ail++l+ kg t+ e g+++ l+ + + ++ + lcl|NCBI__GCF_000020505.1:WP_012501830.1 7 IQKLLAGADLSAQEMEACIDSIMENRFTDAGTGAILALLQKKGVTPTEAIGAYENLMTRVTPITL--PA 73 6899**********************************************************988..69 PP TIGR01245 70 elvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsl 138 ++vD++GTGGD+ t+NiSTa+a++aa+aGv++aKhGnrs++sk+GsaDvLealg++++l + + ++++ lcl|NCBI__GCF_000020505.1:WP_012501830.1 74 HAVDTCGTGGDHRGTFNISTAAAFIAAGAGVPIAKHGNRSITSKCGSADVLEALGYRVDLPASATEEQF 142 ********************************************************************* PP TIGR01245 139 eevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlg 207 +e+g++FlfAP yhp++k+va++R+eLg+rt+fNlLGPL+nPa++k+q +Gv++++++e++a vl + g lcl|NCBI__GCF_000020505.1:WP_012501830.1 143 RETGFAFLFAPLYHPSMKAVASIRRELGIRTLFNLLGPLINPAKVKRQFIGVFDPSVMELYADVLIHAG 211 ********************************************************************* PP TIGR01245 208 vkralvvhg....edglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellk 272 ++a++vhg dglDE s+ g+t+++el +g+ + t++pedfgl+r +++el+gg+ae na++++ lcl|NCBI__GCF_000020505.1:WP_012501830.1 212 CQHAMIVHGktehGDGLDEASVSGPTTIIELFEGRLCHHTVNPEDFGLNRWSIDELAGGDAETNAQIIR 280 *********777669****************************************************** PP TIGR01245 273 evlegkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 ++l g +++a+ d+ ++ a+ yv+g+ + + eg+++ ke+++s +a+e ++++++ lcl|NCBI__GCF_000020505.1:WP_012501830.1 281 QILDGSATQAQIDAALFASAITCYVSGMGSCIDEGMSMSKESLESLAAMENMNRIIE 337 ***************************************************999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.33 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory