Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate WP_012502227.1 CPAR_RS05030 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >NCBI__GCF_000020505.1:WP_012502227.1 Length = 401 Score = 392 bits (1006), Expect = e-113 Identities = 189/388 (48%), Positives = 269/388 (69%), Gaps = 1/388 (0%) Query: 2 KIVLAYSGGLDTSIILKWLKETYR-AEVIAFTADIGQGEEVEEAREKALRTGASKAIALD 60 KI +AYSGGLDTS+++KWLK+ Y AE++A T ++GQ EV+ KAL TGA+ +D Sbjct: 5 KIAVAYSGGLDTSVMIKWLKDKYEGAEIVAVTGNLGQKMEVDNLEPKALATGAASFHFVD 64 Query: 61 LKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGN 120 L++ FV D ++ ++AGA+YE Y L T++ RP++AK LV +A EG + HG TGKGN Sbjct: 65 LRKTFVEDCIWKALKAGALYEDVYPLATALGRPILAKALVDVALAEGCTMLTHGCTGKGN 124 Query: 121 DQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMDANLLH 180 DQVRFE+T +L P +KV+AP REW F R++ I YA H IPV T++ PYS+D N+ Sbjct: 125 DQVRFEVTFASLAPHMKVVAPLREWEFTSREQEITYALEHNIPVSATKKNPYSIDENIWG 184 Query: 181 ISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALLQ 240 IS E GVLEDP PP +++T PEEAPD P V+++F EG PVA++G+++ L+ Sbjct: 185 ISIECGVLEDPMVPPPADAYQITTSPEEAPDKPTVVDIDFVEGIPVALDGQQMEGLDLIV 244 Query: 241 RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRDM 300 +LNE+G +GVGR+D++ENR VG+KSR +YE P TIL+ A R +E LTL++ V + Sbjct: 245 KLNELGAMNGVGRLDMIENRVVGIKSREIYEAPAATILHFAHRELERLTLEKSVFQYKRN 304 Query: 301 LSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYRQ 360 + YA ++Y G W++P REAL A+ D + VTG+ RLKLYKGNV ++GR +P SLY + Sbjct: 305 IGQDYANIIYNGTWFSPMREALDAFVDVTQKPVTGMVRLKLYKGNVTLLGRTSPNSLYNE 364 Query: 361 DLVSFDEAGGYDQKDAEGFIKIQALRLR 388 +L ++ EA ++ K AEGFI++ L L+ Sbjct: 365 ELATYTEADTFNHKAAEGFIQLYGLGLK 392 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 401 Length adjustment: 31 Effective length of query: 369 Effective length of database: 370 Effective search space: 136530 Effective search space used: 136530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012502227.1 CPAR_RS05030 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.8790.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-158 513.3 0.0 3.4e-158 513.0 0.0 1.0 1 lcl|NCBI__GCF_000020505.1:WP_012502227.1 CPAR_RS05030 argininosuccinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020505.1:WP_012502227.1 CPAR_RS05030 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 513.0 0.0 3.4e-158 3.4e-158 1 391 [. 5 396 .. 5 398 .. 0.99 Alignments for each domain: == domain 1 score: 513.0 bits; conditional E-value: 3.4e-158 TIGR00032 1 kvvlaysGGlDtsvalklleek..gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkd 67 k+++aysGGlDtsv++k+l++k gae++avt ++Gq + ++d+ e kal+ Ga + +D r+ fv+d lcl|NCBI__GCF_000020505.1:WP_012502227.1 5 KIAVAYSGGLDTSVMIKWLKDKyeGAEIVAVTGNLGQ-KMEVDNLEPKALATGAASFHFVDLRKTFVED 72 799*******************99*************.6****************************** PP TIGR00032 68 ylfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlk 136 + +a++a+a+ye++Y+l+taL+Rp++ak+lv+va eg+++++hGctgKGnDqvRFe+++ +l+p++k lcl|NCBI__GCF_000020505.1:WP_012502227.1 73 CIWKALKAGALYEDVYPLATALGRPILAKALVDVALAEGCTMLTHGCTGKGNDQVRFEVTFASLAPHMK 141 ********************************************************************* PP TIGR00032 137 viaPvreleli.ReeeieyaaekGievpvekekaysiDenllgrsiEageLEdpsteppediyelvkdp 204 v+aP+re+e++ Re+ei ya e+ i+v ++k+++ysiDen++g+siE+g LEdp++ pp d+y+++ +p lcl|NCBI__GCF_000020505.1:WP_012502227.1 142 VVAPLREWEFTsREQEITYALEHNIPVSATKKNPYSIDENIWGISIECGVLEDPMVPPPADAYQITTSP 210 **********99*******************************************************99 PP TIGR00032 205 iektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEapa 273 +e++ d+p vv+i+F +G+Pval+g+++e ++li k+ne++ +GvGr+D++E+R++g+KsReiYEapa lcl|NCBI__GCF_000020505.1:WP_012502227.1 211 EEAP-DKPTVVDIDFVEGIPVALDGQQMEGLDLIVKLNELGAMNGVGRLDMIENRVVGIKSREIYEAPA 278 9998.**************************************************************** PP TIGR00032 274 lllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrvklfk 342 +++L+ Ah++Le l+l+k+v ++k+ +++ y+++iY+G wf+p +ealda+++ tq+ vtG+vr+kl+k lcl|NCBI__GCF_000020505.1:WP_012502227.1 279 ATILHFAHRELERLTLEKSVFQYKRNIGQDYANIIYNGTWFSPMREALDAFVDVTQKPVTGMVRLKLYK 347 ********************************************************************* PP TIGR00032 343 GnaivigrkseyslYdeelvsfekdkefdqkdaiGfikirglqikvyre 391 Gn++ +gr+s++slY+eel+++++ ++f++k+a+Gfi+++gl k+y+e lcl|NCBI__GCF_000020505.1:WP_012502227.1 348 GNVTLLGRTSPNSLYNEELATYTEADTFNHKAAEGFIQLYGLGLKTYSE 396 ********************************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.68 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory