Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (characterized)
to candidate WP_012502991.1 CPAR_RS08940 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
Query= SwissProt::O06491 (485 letters) >NCBI__GCF_000020505.1:WP_012502991.1 Length = 481 Score = 444 bits (1141), Expect = e-129 Identities = 225/462 (48%), Positives = 311/462 (67%), Gaps = 3/462 (0%) Query: 10 ELKQLIHKKEIKISDLVDESYKRIQAVDDKVQAFLALDEERARAYAKELDEAVDGRSEHG 69 +L+ + +E+ ++ E +RI + D F A+ E A A+ELD ++ E G Sbjct: 8 DLRSKLLSRELTCEQVISEYLQRIDSKKDD-NIFTAVFHEAALERARELDAKLERGEEPG 66 Query: 70 LLFGMPIGVKDNIVTKGLRTTCSSKILENFDPIYDATVVQRLQDAEAVTIGKLNMDEFAM 129 +LFGMPI +KDNI KG +C+SKIL+ ++ +YDAT ++R+ +A+ +G+ NMDEFAM Sbjct: 67 VLFGMPIAIKDNISMKGAPLSCASKILDGYESVYDATAIERMVAEDAIFVGRTNMDEFAM 126 Query: 130 GSSTENSAYKLTKNPWNLDTVPGGSSGGSAAAVAAGEVPFSLGSDTGGSIRQPASFCGVV 189 GSS ENSA NP++ VPGGSSGGSAAAVA +LGSDTGGS+RQP FC VV Sbjct: 127 GSSNENSAIGPVPNPFDKTRVPGGSSGGSAAAVANDLCMVALGSDTGGSVRQPGGFCNVV 186 Query: 190 GLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAFLLQAISGVDKMDSTSANVDVPDFL 249 GLKPTYGR+SRYGLVAFASS DQIG + +D A +L I+G D D+TS++ +VPD+ Sbjct: 187 GLKPTYGRISRYGLVAFASSFDQIGVLAANCDDAALVLGVIAGQDDRDATSSHHEVPDYE 246 Query: 250 SSLTG-DIKGLKIAVPKEYLGEGVGKEARESVLAALKVLEGLGATWEEVSLPHSKYALAT 308 S++ ++GL++ VP + E + + V A LK LE GA E+ LP S YA+A Sbjct: 247 STMDHVSLEGLRVGVPSAFFPENLNADVAGVVKAGLKKLEDAGAELVEIELPESDYAIAA 306 Query: 309 YYLLSSSEASANLARFDGIRYGYRTDNADNLIDLYKQTRAEGFGNEVKRRIMLGTFALSS 368 YY+L ++EAS+NLARFDG RYGYR+ ++ +L +Y +R EGFG EVKRRIMLGT+ LS+ Sbjct: 307 YYILVTAEASSNLARFDGARYGYRSPDSPDLSSMYVNSRTEGFGAEVKRRIMLGTYVLSA 366 Query: 369 GYYDAYYKKAQKVRTLIKKDFEDVFEKYDVIVGPTTPTPAFKIGENTKDPLTMYANDILT 428 GYYD YYKKAQ+VR + ++ + + FEK DVI GPT+P P F IG+ +PL MY D+ T Sbjct: 367 GYYDTYYKKAQQVRRVFQEKYREAFEKVDVIAGPTSPFPPFGIGDKMDNPLEMYLADVFT 426 Query: 429 IPVNLAGVPGISVPCGLAD-GLPLGLQIIGKHFDESTVYRVA 469 +P ++ G+P +SVP G GLP+G+ +I F+E + +A Sbjct: 427 VPASIVGMPAVSVPVGFDSLGLPVGVHLICNFFEEGKMLGIA 468 Lambda K H 0.315 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 617 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 485 Length of database: 481 Length adjustment: 34 Effective length of query: 451 Effective length of database: 447 Effective search space: 201597 Effective search space used: 201597 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
Align candidate WP_012502991.1 CPAR_RS08940 (Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A)
to HMM TIGR00132 (gatA: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit (EC 6.3.5.-))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00132.hmm # target sequence database: /tmp/gapView.2408.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00132 [M=466] Accession: TIGR00132 Description: gatA: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-181 588.9 0.0 4.1e-181 588.7 0.0 1.0 1 lcl|NCBI__GCF_000020505.1:WP_012502991.1 CPAR_RS08940 Asp-tRNA(Asn)/Glu-t Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020505.1:WP_012502991.1 CPAR_RS08940 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 588.7 0.0 4.1e-181 4.1e-181 2 463 .. 10 474 .. 9 477 .. 0.98 Alignments for each domain: == domain 1 score: 588.7 bits; conditional E-value: 4.1e-181 TIGR00132 2 kellkkkevsikevleeilerieavkdkinaflevtkekalkkakkldkkva..ke.kklagipiavKd 67 +++l ++e++ ++v++e+l+ri+++kd n+f++v +e al++a++ld+k++ +e l+g+pia+Kd lcl|NCBI__GCF_000020505.1:WP_012502991.1 10 RSKLLSRELTCEQVISEYLQRIDSKKD-DNIFTAVFHEAALERARELDAKLErgEEpGVLFGMPIAIKD 77 6778899*****************999.8**********************9865545*********** PP TIGR00132 68 niavkdiettcaSkiLenyvspydatVverlkeagaliiGktNlDEFamGsstetSafgvtknPeneer 136 ni++k+ +++caSkiL++y s+ydat +er+ +++a+ +G+tN+DEFamGss e+Sa g++ nP +++r lcl|NCBI__GCF_000020505.1:WP_012502991.1 78 NISMKGAPLSCASKILDGYESVYDATAIERMVAEDAIFVGRTNMDEFAMGSSNENSAIGPVPNPFDKTR 146 ********************************************************************* PP TIGR00132 137 vpGGSsgGsaaavaadlvplalgsDTGgSiRqPAsfcgvvGlKPtYGlvSRyGlvayasSldqiGilak 205 vpGGSsgGsaaava dl+ +algsDTGgS+RqP fc+vvGlKPtYG++SRyGlva+asS+dqiG+la+ lcl|NCBI__GCF_000020505.1:WP_012502991.1 147 VPGGSSGGSAAAVANDLCMVALGSDTGGSVRQPGGFCNVVGLKPTYGRISRYGLVAFASSFDQIGVLAA 215 ********************************************************************* PP TIGR00132 206 kvedialvldvisgkDkkDstslevkveelleelkk.dlkglkvgvvkelseesldkevkekfekllek 273 + +d+alvl vi+g+D +D ts + +v+++ +++ + l gl+vgv ++ e+l+ +v+ +++ l+k lcl|NCBI__GCF_000020505.1:WP_012502991.1 216 NCDDAALVLGVIAGQDDRDATSSHHEVPDYESTMDHvSLEGLRVGVPSAFFPENLNADVAGVVKAGLKK 284 ******************************999999789****************************** PP TIGR00132 274 leelgaeivevslpsvklalaiYyiispsEassnlarydgiryGkrveelkslkelyaktRsegfgeev 342 le+ gae+ve++lp++++a+a+Yyi+ ++Eassnlar+dg ryG+r + +l+ +y+++R egfg+ev lcl|NCBI__GCF_000020505.1:WP_012502991.1 285 LEDAGAELVEIELPESDYAIAAYYILVTAEASSNLARFDGARYGYRSPDSPDLSSMYVNSRTEGFGAEV 353 ********************************************************************* PP TIGR00132 343 krRimlGayalskeyydkyykkAqkvrtliidefeklfeevDvivsptaptlafklgekaedplemyls 411 krRimlG+y+ls++yyd yykkAq+vr++ +++++++fe+vDvi++pt+p +f +g+k+++plemyl+ lcl|NCBI__GCF_000020505.1:WP_012502991.1 354 KRRIMLGTYVLSAGYYDTYYKKAQQVRRVFQEKYREAFEKVDVIAGPTSPFPPFGIGDKMDNPLEMYLA 422 ********************************************************************* PP TIGR00132 412 DvltvpanlaGlpaisvPlgkkekglpiGlqiigkafddkkllsvakaleqa 463 Dv+tvpa+++G+pa+svP+g ++ glp+G+ +i + f++ k+l +a++l+++ lcl|NCBI__GCF_000020505.1:WP_012502991.1 423 DVFTVPASIVGMPAVSVPVGFDSLGLPVGVHLICNFFEEGKMLGIARNLQAL 474 **********************************************998865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (466 nodes) Target sequences: 1 (481 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 7.29 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory