Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate WP_012503135.1 CPAR_RS09705 homoserine kinase
Query= reanno::Cola:Echvi_2001 (311 letters) >NCBI__GCF_000020505.1:WP_012503135.1 Length = 324 Score = 315 bits (808), Expect = 7e-91 Identities = 168/321 (52%), Positives = 216/321 (67%), Gaps = 12/321 (3%) Query: 1 MKKVTAFAPATVANVSCGFDILGFAVEEMGDKVTVSLADEPG----VRVVRIEGDGGRLP 56 MK VT FA ATV NV+CGFD+LGFA+ E GD+V ++L DEP V + I GDGG LP Sbjct: 1 MKTVTGFASATVGNVACGFDVLGFAITEPGDEVILTLHDEPRSGSPVTITSISGDGGALP 60 Query: 57 YEVDKNTCGVALKAFLA------AIDYKGGLEVELYKGLPLGSGMGSSAASSVAALEAAN 110 + KNT + FL ID+KG +++EL K LPL SGMGSSAAS+ AAL AAN Sbjct: 61 LDPKKNTSSFVVLKFLEYIRSTKGIDFKGHIDLELKKHLPLSSGMGSSAASAAAALVAAN 120 Query: 111 QLLGNPLDKKALLPFAMKAEGVACGAEHADNVAPSLLGGFVLIRSYHPLDVTKLHVPKGL 170 +LLG+P K L+ FA++ E VACG+ HADN AP++LG F+LIRSYHPLD+ + PK L Sbjct: 121 ELLGSPCSKMELVHFAIEGERVACGSAHADNAAPAMLGNFILIRSYHPLDLITIRPPKDL 180 Query: 171 YCALVHPHLELNTADSRSVLRQQVPLKDAITQSGNIAGLVAGLYQEDMGLISRSLQDVIA 230 +C LVHPH E+ T+ +RSVL + +PL AI Q GN+ LV+GL ED LI R+L DV+A Sbjct: 181 FCTLVHPHTEVKTSFARSVLPKSIPLSMAIQQWGNVGALVSGLLMEDYDLIGRALVDVVA 240 Query: 231 EPSRSVLIPGFDEIKSAIKEVGALGVGISGSGPTTFILAPSREVAERASEICQEVF--DK 288 EP R+ LIPGF+E+K A + GALG I+GSGP+ F + SR AE QE F K Sbjct: 241 EPKRAPLIPGFNEVKQAALDAGALGCSIAGSGPSVFAFSSSRATAETVGAAMQETFKLSK 300 Query: 289 IGLEVDLYVSAVNTKGTYVIN 309 L+ D++VS V ++G VI+ Sbjct: 301 AELDSDMWVSPVCSQGARVIS 321 Lambda K H 0.317 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 311 Length of database: 324 Length adjustment: 27 Effective length of query: 284 Effective length of database: 297 Effective search space: 84348 Effective search space used: 84348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_012503135.1 CPAR_RS09705 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.7770.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-62 197.7 0.0 1.3e-62 197.3 0.0 1.0 1 lcl|NCBI__GCF_000020505.1:WP_012503135.1 CPAR_RS09705 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020505.1:WP_012503135.1 CPAR_RS09705 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 197.3 0.0 1.3e-62 1.3e-62 6 283 .. 9 299 .. 5 321 .. 0.83 Alignments for each domain: == domain 1 score: 197.3 bits; conditional E-value: 1.3e-62 TIGR00191 6 PassANlgpGfDvlGlalslv.lellvtedvaqeskdk.sleaegegvekipkesdkNliyqvakkvlk 72 a+ N++ GfDvlG a+++ +e+++t + + s + +++ + + +p++++kN v++k+l+ lcl|NCBI__GCF_000020505.1:WP_012503135.1 9 SATVGNVACGFDVLGFAITEPgDEVILTLHDEPRSGSPvTITSISGDGGALPLDPKKNTSSFVVLKFLE 77 58999*************9882455555533333333367888888889*********66666555555 PP TIGR00191 73 ....klgkr.vkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEg..... 131 + g++ + l+++k++pl++G+GSSaa+ +aa++aanel+g ++sk+el+++a++ E+ lcl|NCBI__GCF_000020505.1:WP_012503135.1 78 yirsTKGIDfKGHIDLELKKHLPLSSGMGSSAASAAAALVAANELLGSPCSKMELVHFAIEGERvacgs 146 111056666555689****************************************************** PP TIGR00191 132 .HpDNvapallGGlqlavkedd.llevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnl 198 H+DN+apa+lG + l +++ l++++ P ++l + lv P+ ev+T aR vLPk+ +++ ++++ lcl|NCBI__GCF_000020505.1:WP_012503135.1 147 aHADNAAPAMLGNFILIRSYHPlDLITIRPP--KDLFCTLVHPHTEVKTSFARSVLPKSIPLSMAIQQW 213 ****************999998445566666..89********************************** PP TIGR00191 199 shlavlvtAlvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaee 267 +++ lv l ++ dl+ a+ D+v++p+R+ liP+++e+kqaa ++galg + G+Gp+++a+++ lcl|NCBI__GCF_000020505.1:WP_012503135.1 214 GNVGALVSGLLME-DYDLIGRALVDVVAEPKRAPLIPGFNEVKQAALDAGALGCSIAGSGPSVFAFSSS 281 *************.8999999*********************************************999 PP TIGR00191 268 ek.eeka.qelleklake 283 +e + + + e+++ lcl|NCBI__GCF_000020505.1:WP_012503135.1 282 RAtAETVgAAMQETFKLS 299 885443303333333333 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.83 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory