Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_012503182.1 CPAR_RS09930 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_000020505.1:WP_012503182.1 Length = 271 Score = 161 bits (407), Expect = 2e-44 Identities = 92/244 (37%), Positives = 132/244 (54%), Gaps = 10/244 (4%) Query: 17 RLLAPEGCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVMFLLAFLGRLY 76 R+L E CPWD++QTPESL L+EE +ELV AI +G+ E+++E+GD+ + F L Sbjct: 36 RVLRSE-CPWDRKQTPESLAHLLLEESYELVHAIDTGDDPELKKELGDLFLHVCFQVLLA 94 Query: 77 ADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKRAEKADAEGEPQGV 136 + G F+ D K+I RHPHVF D L NWE++K E + + Sbjct: 95 DEAGKFSFVDVFEALCHKLISRHPHVFGDVKADTEQAVLGNWENLKMKEGR------KSL 148 Query: 137 YDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELLDVLAGDDKAAQENE 196 + +P ++ LL+AYR+ K A VGF WP DE V ++ E EL DK+ +E E Sbjct: 149 LEGVPNAMSELLRAYRVQKKVAGVGFDWPSDEGVLDKLTEEIGELRHAA---DKSEREEE 205 Query: 197 LGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERGLDFPALSLDDKDELW 256 GDL+F++V R AL KF+ RFR++E + G + S ++ D LW Sbjct: 206 FGDLLFTIVNYSRFIDTNPEDALRKATNKFMDRFRKVEESVQASGKSWQEFSAEELDSLW 265 Query: 257 NEAK 260 NEAK Sbjct: 266 NEAK 269 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 271 Length adjustment: 25 Effective length of query: 242 Effective length of database: 246 Effective search space: 59532 Effective search space used: 59532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory