Align asparagine synthase (glutamine-hydrolysing) 3; EC 6.3.5.4 (characterized)
to candidate WP_012504711.1 PAES_RS00550 N-acetylglutaminylglutamine amidotransferase
Query= CharProtDB::CH_007942 (614 letters) >NCBI__GCF_000020625.1:WP_012504711.1 Length = 592 Score = 256 bits (653), Expect = 3e-72 Identities = 176/587 (29%), Positives = 282/587 (48%), Gaps = 40/587 (6%) Query: 1 MCGITGWVDFKKQLVQEKQTMDRMTDTLSKRGPDDSNVWGEHHVLFGHKRLAVVDIEG-G 59 MCGI G + F T+D M L RGPD V+ + + FGH+RL ++D+ Sbjct: 1 MCGIAGELRFDSAAASST-TVDAMLGILEPRGPDAQGVFAHNRICFGHRRLKIIDLSDCA 59 Query: 60 RQPMACTYKGDTYTIIYNGELYNTEDLRKELRARGHQFERTSDTEVLLHSYIEWQEDCVD 119 QPM + G +++NG +YN +L EL +G+ F SDTE+++ +Y W EDCV Sbjct: 60 SQPMVDSALG--LVLVFNGAVYNYRELCTELVGKGYSFFSQSDTEIIIKAYHAWGEDCVG 117 Query: 120 HLNGIFAFAVWDEKRNLLFAARDRLGVKPFFYTKEGSSFLFGSEIKAILAHPDIKARVDR 179 HL G+FAFA+W+ F ARDRLG+KP ++T++ +S F S + A+L + +D Sbjct: 118 HLQGMFAFAIWERDTGRTFFARDRLGIKPLYFTEDNASMRFASSLPALLKSGAVDTAIDP 177 Query: 180 TGLSEIFGLGPSRTPGTGIFKGIKEIRPAHALTFSKDGLNIWR-YWNVE----SEKHTDS 234 L IF+GI+++ PA + DG R YW + E+ S Sbjct: 178 AALDCYMSFHSVVPAPWTIFRGIRKLPPATTMMVEPDGRKQQRTYWQPDYSRSDEERRRS 237 Query: 235 FDDTVANVRSLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAGHFEKEGKAPLHTYSI 294 + + V + AV R+LV+DVPV LSGGLDSS + + + ++ L T+S+ Sbjct: 238 AGEWIDAVHDALKLAVQRRLVADVPVGVLLSGGLDSSLVVGLLSELVQRH----LSTFSV 293 Query: 295 DYEENDKYFQASAFQPNDDGPWIEKMTEAFGTTHHKCVISQKDLVDHLEEAVLVKDLPGM 354 +E+ A + ++ + + + E + T HHK + ++L HL + V P + Sbjct: 294 GFED-------VAEEEGNEFRYSDIIAERYSTDHHKIFVDHRELQTHLSDCVRAMSEPMV 346 Query: 355 ADVDSSLLWFCREIKKDFVVSLSGECADEIFGGYPWF----HTADVE-----SGFPWMRS 405 + RE+ + V SG+ ADE+F GY W+ +T E SG + R Sbjct: 347 SHDVIGFYLLSREVSQHVRVVQSGQGADEVFAGYHWYPPMMNTPPTEAYSTYSGVFFDRD 406 Query: 406 TEERIKLLSDSWQKKLNLKEYVNAKYEETLAETPLLDGETGVDKARRQLFYLNMLWFMTN 465 E + ++ S+ + + +V + AE P +DKA R + + + + Sbjct: 407 FNEYRQAVNSSFITEDHAAAFVRNHFAMPGAEEP-------IDKALR---LDSTIMLVDD 456 Query: 466 LLDRKDRMSMGASLEVRVPFADHRLVEYVWNIPWEMKMHDNREKGILRKALEGILPDDIL 525 + R D M+M LE RVPF DH LVE IP E K+ D K +L++ I+P +++ Sbjct: 457 PVKRVDNMTMAWGLEARVPFLDHELVELAAKIPAEYKVKDG-GKYVLKEVGRRIIPHEVI 515 Query: 526 YRKKSPYPKTHHPEYTKGVSEWLKTIRSQKDSVLHTLLDRKQLDQLL 572 R K +P + K I +Q + + +R+ +D LL Sbjct: 516 DRPKGYFPVPALKYLEGEYLDMAKNILNQDAAKQRKIFNREYVDMLL 562 Lambda K H 0.320 0.137 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 860 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 614 Length of database: 592 Length adjustment: 37 Effective length of query: 577 Effective length of database: 555 Effective search space: 320235 Effective search space used: 320235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
Align candidate WP_012504711.1 PAES_RS00550 (N-acetylglutaminylglutamine amidotransferase)
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.18766.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-139 450.3 0.0 6.6e-139 450.1 0.0 1.0 1 lcl|NCBI__GCF_000020625.1:WP_012504711.1 PAES_RS00550 N-acetylglutaminylg Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020625.1:WP_012504711.1 PAES_RS00550 N-acetylglutaminylglutamine amidotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 450.1 0.0 6.6e-139 6.6e-139 1 516 [. 2 521 .. 2 522 .. 0.94 Alignments for each domain: == domain 1 score: 450.1 bits; conditional E-value: 6.6e-139 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkdekeenailghrRLaiidlseg.aQPlsne 68 Cgiag + + +a++ + ++++ml l+ RGPDa+gv+ + ++ ++ghrRL iidls+ QP+ + lcl|NCBI__GCF_000020625.1:WP_012504711.1 2 CGIAGELRFDSAAAS-STTVDAMLGILEPRGPDAQGVFAH---NRICFGHRRLKIIDLSDCaSQPMVDS 66 *********998777.59**********************...7****************99******* PP TIGR01536 69 k.evvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewgeelverLeGmFAfalwdekkgel 136 + v+vfnG +YN++eL el kGy+F ++sDtE+i++ay++wge++v +L+GmFAfa+w++ +g+ lcl|NCBI__GCF_000020625.1:WP_012504711.1 67 AlGLVLVFNGAVYNYRELCTELVGKGYSFFSQSDTEIIIKAYHAWGEDCVGHLQGMFAFAIWERDTGRT 135 **9****************************************************************** PP TIGR01536 137 flaRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlq.lvptektlfkevkele 204 f aRDrlGikPLY+++++ ++ faS + all+ ++++++d +al +++++ +vp + t+f+++++l+ lcl|NCBI__GCF_000020625.1:WP_012504711.1 136 FFARDRLGIKPLYFTEDNASMRFASSLPALLKSGAVDTAIDPAALDCYMSFHsVVPAPWTIFRGIRKLP 204 ****************************************************9999************* PP TIGR01536 205 pakal....dgeekleeywevekee....vkeseeelveelrelledavkkrlvadvpvgvllSGGlDS 265 pa + dg ++ ++yw+ ++++ ++ s e ++ + ++l+ av++rlvadvpvgvllSGGlDS lcl|NCBI__GCF_000020625.1:WP_012504711.1 205 PATTMmvepDGRKQQRTYWQPDYSRsdeeRRRSAGEWIDAVHDALKLAVQRRLVADVPVGVLLSGGLDS 273 ****9997766666777***99988666788888999******************************** PP TIGR01536 266 slvaaiakkeaksevktFsigfe..dskdldeskaarkvadelgtehkevliseeevlkeleevilale 332 slv+ ++++ +++++ tFs+gfe +++ +e ++ +a+ t+h+++ +++ e+ +l + ++a+ lcl|NCBI__GCF_000020625.1:WP_012504711.1 274 SLVVGLLSELVQRHLSTFSVGFEdvAEEEGNEFRYSDIIAERYSTDHHKIFVDHRELQTHLSDCVRAMS 342 ***********************66677888899*********************************** PP TIGR01536 333 eptairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeealelpeaselaekklllqak 401 ep+ +++i+ ylls++++++ v+Vv sG+GaDE+f+GY+++ + ++ e + +++ ++ ++ lcl|NCBI__GCF_000020625.1:WP_012504711.1 343 EPMVSHDVIGFYLLSREVSQH-VRVVQSGQGADEVFAGYHWYPPMMNTPPTE----AYSTYSGVFFDRD 406 *********************.**********************99998887....2234566788999 PP TIGR01536 402 lakeselkellkakleeelkekeelkkelkeeseleellrldlelllsdl.lrakDrvsmahslEvRvP 469 +++ + + + +++ + ++++++ +e+ ++++lrld + +l d+ +++ D ++ma++lE+RvP lcl|NCBI__GCF_000020625.1:WP_012504711.1 407 FNEYRQAVNSSFITEDHAAAFVRNHFAMPGAEEPIDKALRLDSTIMLVDDpVKRVDNMTMAWGLEARVP 475 99999998888888899999999999999999**********9988877626666************** PP TIGR01536 470 flDkelvelalsippelklrdgkeKvlLreaaeellPeeileRkKea 516 flD+elvela++ip+e+k++dg K++L+e+ ++++P+e+ +R+K lcl|NCBI__GCF_000020625.1:WP_012504711.1 476 FLDHELVELAAKIPAEYKVKDG-GKYVLKEVGRRIIPHEVIDRPKGY 521 ********************98.7********************965 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (592 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 12.94 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory