Align Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 (characterized)
to candidate WP_012505403.1 PAES_RS04110 imidazoleglycerol-phosphate dehydratase HisB
Query= SwissProt::Q8ABA7 (374 letters) >NCBI__GCF_000020625.1:WP_012505403.1 Length = 200 Score = 185 bits (470), Expect = 8e-52 Identities = 97/193 (50%), Positives = 128/193 (66%), Gaps = 4/193 (2%) Query: 184 RKAEVRRTTKETDIYVSLNLDGNGGCDISTGLGFFDHMLEQIGKHSGMDLTIRVKGDLEV 243 R A V R T ETDI + LNLDG G IS+G+ F DHML KH+ +D+T+ KGD +V Sbjct: 10 RSASVSRRTSETDISIDLNLDGTGTHSISSGVVFLDHMLANFSKHAQIDITLTCKGDTDV 69 Query: 244 DEHHTIEDTAIALGECIYQALGSKRGIERYGYA-LPMDDCLCQVCLDFGGRPWLVWDAEF 302 D+HH++ED A+ LG + Q+LG K+GI+RYG++ +PMD+ L + LD GGR + V++A F Sbjct: 70 DDHHSVEDIALVLGSALLQSLGDKKGIKRYGWSMIPMDEALARCALDLGGRSYSVFNATF 129 Query: 303 NREKIGEMPTEMFLHFFKSLSDAAKMNLNIK-AEGQNEHHKIEGIFKALARALKMALKRD 361 NR + TEM HFF SLS N++I EGQN HHKIE IFKA A ALK A+ Sbjct: 130 NRSVVNGFSTEMVEHFFLSLSRTLHANIHISILEGQNTHHKIEAIFKAFAYALKDAI--S 187 Query: 362 IYHFELPSSKGVL 374 I +PS+KGV+ Sbjct: 188 ISGTGIPSTKGVI 200 Lambda K H 0.321 0.140 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 200 Length adjustment: 25 Effective length of query: 349 Effective length of database: 175 Effective search space: 61075 Effective search space used: 61075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory