Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_012505537.1 PAES_RS04825 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::D2Z0I0 (402 letters) >NCBI__GCF_000020625.1:WP_012505537.1 Length = 404 Score = 424 bits (1090), Expect = e-123 Identities = 210/398 (52%), Positives = 283/398 (71%), Gaps = 4/398 (1%) Query: 1 MSEEWMFPKVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVAN 60 M +E F K+K+LPKYVFA VNELK RR+GED++D MGNPD P QHIIDKL E Sbjct: 1 MFDEIEFEKIKRLPKYVFAAVNELKMAERRKGEDVIDFSMGNPDGPTPQHIIDKLVESVQ 60 Query: 61 RPNVHGYSASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGD 120 +P HGYS SKGI +LR AIC +Y+ +YGVELD + + ++G+KEGY +L+ A+ PGD Sbjct: 61 KPRTHGYSVSKGIYKLRLAICGWYRDKYGVELDADTEVVASMGSKEGYVNLVQAITNPGD 120 Query: 121 TVIVPNPTYPIHYYAPIICGGDAISVPILPEEDF---PEVFLRRLYDLIKTSFRKPKAVV 177 +VP+P YPIH A I+ GG+ + +E++ E F R + ++ S KPK +V Sbjct: 121 IAMVPDPCYPIHSQAFILAGGNVHRFKLEMDEEYRLDEEAFFRNIETAMRESSPKPKYLV 180 Query: 178 LSFPHNPTTLCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVA 237 ++FP+NPTT V+ F++ +V+ A++E +I+ D AYA++ +DGY PSILQV GA DVA Sbjct: 181 VNFPNNPTTATVERSFYERLVETARRERFYIISDIAYAEITYDGYQSPSILQVPGAKDVA 240 Query: 238 VELYSMSKGFSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVV 297 VE Y++SK ++MAGWRV F+VGN L+ L +KS+LDYG+FTPIQVAS IAL S V Sbjct: 241 VESYTLSKTYNMAGWRVGFLVGNPKLVGALMRIKSWLDYGMFTPIQVASTIALNSDQSCV 300 Query: 298 EKNREIYRRRRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEEV-GMNSLDFSLFLLREAKV 356 + R+ YR+RRDV+++ GWE++ P+ SMF+WA++PE + + SL+FS LLREAKV Sbjct: 301 AEIRDTYRKRRDVMLKSFANAGWEIRAPRASMFLWARIPEPLRQVGSLEFSKMLLREAKV 360 Query: 357 AVSPGIGFGEYGEGYVRFALVENEHRIRQAVRGIKKAL 394 AVSPGIGFG G+ YVR AL+ENE RIRQA R I+K L Sbjct: 361 AVSPGIGFGPNGDEYVRIALIENEERIRQAARNIRKFL 398 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 404 Length adjustment: 31 Effective length of query: 371 Effective length of database: 373 Effective search space: 138383 Effective search space used: 138383 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory