Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate WP_012506211.1 PAES_RS08295 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::P9WPZ5 (397 letters) >NCBI__GCF_000020625.1:WP_012506211.1 Length = 404 Score = 129 bits (325), Expect = 1e-34 Identities = 110/358 (30%), Positives = 169/358 (47%), Gaps = 23/358 (6%) Query: 16 EMSALATRIGAVNLGQ----GFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIA 71 ++ A +I +N+G GF P ++++A A+ G N Y P G AIA Sbjct: 31 KLEAQGKKITYLNIGDPVLYGFQP---PEELIEANVLALRHGHNGYSPSSGRKEAVEAIA 87 Query: 72 AQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGA 131 R G+ P+ V++T GA+EA ++ PG EVL P Y Y+ ++A A Sbjct: 88 EDACRR-GISTSPDN-VIITFGASEAADLVCTSMLNPGDEVLCPSPGYPLYNAIIAKLNA 145 Query: 132 HRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAA 191 V L P + D + + +++TPRT+ L++ +P+NPTG + S L +IA Sbjct: 146 REVRYSLDP-ANDWLPDPEQVEKSITPRTKILVVINPNNPTGELYSRETLDMFVDIARRH 204 Query: 192 NLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGW-ACGPAEL 250 L++ITDEVY LV++ H+PLA ITI S +K + GW+ GW + L Sbjct: 205 KLLIITDEVYHKLVYE-GEHIPLASLASDDVAVITIDSLSKNYMAPGWRTGWLMITNSAL 263 Query: 251 IAGVRAAKQYLSYVG-GAPFQP--AVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-G 306 I VR A L+ AP P + A+ + + + LRA+R+ L I G Sbjct: 264 IPDVRQAFIKLADARLCAPMAPQYTIKAAMTMGPEYNETILSRLRAQRELTIDRLNAIEG 323 Query: 307 FAVHDSYGTYF----LCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAF-CDPAAGQA 359 F+ + G ++ L D P D+ EF L ++ V + S F DPA+G A Sbjct: 324 FSCNKPSGAFYVMGKLDLDATPFKTDE--EFVLKLLQEKQVLFVHGSGFGTDPASGYA 379 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 404 Length adjustment: 31 Effective length of query: 366 Effective length of database: 373 Effective search space: 136518 Effective search space used: 136518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory