Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_012506211.1 PAES_RS08295 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_000020625.1:WP_012506211.1 Length = 404 Score = 172 bits (436), Expect = 2e-47 Identities = 119/369 (32%), Positives = 184/369 (49%), Gaps = 23/369 (6%) Query: 23 ALELRRQGVDLVALTAGEP---DFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAE 79 A +L QG + L G+P F PE + EA AL G Y+P +G E EA+AE Sbjct: 29 ARKLEAQGKKITYLNIGDPVLYGFQPPEELIEANVLALRHGHNGYSPSSGRKEAVEAIAE 88 Query: 80 KFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVV 139 R G+S +P+ I+T G +A + ++L+PGDEV+ SP + Y ++ Sbjct: 89 DACRR-GISTSPDNVIITFGASEAADLVCTSMLNPGDEVLCPSPGYPLYNAIIAKLNARE 147 Query: 140 VEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFY 199 V P ++PDPE+V ++ITPRTK LVV +PNNPTG +Y +E L+ +A H Sbjct: 148 VRYSLDPANDWLPDPEQVEKSITPRTKILVVINPNNPTGELYSRETLDMFVDIARRHKLL 207 Query: 200 LVSDEIYEHLLYEGEHFSPGRVAPEH--TLTVNGAAKAFAMTGWRIGY-----ACGPKEV 252 +++DE+Y L+YEGEH +A + +T++ +K + GWR G+ + +V Sbjct: 208 IITDEVYHKLVYEGEHIPLASLASDDVAVITIDSLSKNYMAPGWRTGWLMITNSALIPDV 267 Query: 253 IKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTAL-G 311 +A ++ +P Q+ A+T + E R +R+L ++ L A+ G Sbjct: 268 RQAFIKLADARLCAP-MAPQYTIKAAMT---MGPEYNETILSRLRAQRELTIDRLNAIEG 323 Query: 312 LKAVRPSGAFYVL----MDTSPIAPDEVRAAERLLEAGVAVVPGTDFA---AFGHVRLSY 364 +PSGAFYV+ +D +P DE + L E V V G+ F A G+ R+ Y Sbjct: 324 FSCNKPSGAFYVMGKLDLDATPFKTDEEFVLKLLQEKQVLFVHGSGFGTDPASGYARIVY 383 Query: 365 ATSEENLRK 373 L K Sbjct: 384 LPDVTILEK 392 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 404 Length adjustment: 31 Effective length of query: 354 Effective length of database: 373 Effective search space: 132042 Effective search space used: 132042 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory