Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_012506650.1 PAES_RS10520 carbamoyl-phosphate synthase small chain
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_000020625.1:WP_012506650.1 Length = 371 Score = 365 bits (938), Expect = e-106 Identities = 186/380 (48%), Positives = 255/380 (67%), Gaps = 21/380 (5%) Query: 5 ALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVG 64 A LVLE+G+ + G A G G GEVVFNT++TGYQEI+TDPSY+ Q+V +TYP IGN G Sbjct: 6 AKLVLENGSVYTGYAFGHIGETGGEVVFNTALTGYQEIVTDPSYAGQMVVMTYPLIGNYG 65 Query: 65 TNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLRE 124 N +D ES ++ A L++R++ I SNF T L YLK ++ +A IDTRKL R +R+ Sbjct: 66 VNQSDAESQKIWASALIVREMSNIHSNFAATGSLDQYLKEAKVMGLAGIDTRKLVREIRQ 125 Query: 125 KGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEA 184 KGA G I A D PD EKA P + G+DL K+V+T++ Y+ Sbjct: 126 KGAMRGVISAID-PDEKRLEEKALKIPEMTGLDLVKKVSTSQTYTIDC------------ 172 Query: 185 KKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGD 244 D+ +HVVAYD+G K+NILRML + C++T++ A T E+ LK++PDGIFLSNGPGD Sbjct: 173 ---DDAEYHVVAYDYGIKQNILRMLQNAKCKVTVLNANTPIEEALKLDPDGIFLSNGPGD 229 Query: 245 PAPCDYAITAIQKFLETD-----IPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKD 299 P YAI I+K E + +P+FGICLGHQL++LA GAKT K+KFGHHG NHPVK+ Sbjct: 230 PFAVTYAIDNIKKLAEHNTQQKPVPLFGICLGHQLMSLAFGAKTYKLKFGHHGSNHPVKN 289 Query: 300 VEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPG 359 ++ + + IT+QNHGFAV +LP +L +TH +L+D T++G+ P FS Q HPEA+PG Sbjct: 290 LKSSSIEITSQNHGFAVAMESLPESLEMTHLNLYDQTVEGVRHKKLPCFSVQYHPEAAPG 349 Query: 360 PHDAAPLFDHFIELIEQYRK 379 PHD+ LF+ F +++Q ++ Sbjct: 350 PHDSHYLFEQFTAMMDQAKE 369 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 371 Length adjustment: 30 Effective length of query: 352 Effective length of database: 341 Effective search space: 120032 Effective search space used: 120032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_012506650.1 PAES_RS10520 (carbamoyl-phosphate synthase small chain)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.8944.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-155 502.3 0.3 4.1e-155 502.1 0.3 1.0 1 lcl|NCBI__GCF_000020625.1:WP_012506650.1 PAES_RS10520 carbamoyl-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020625.1:WP_012506650.1 PAES_RS10520 carbamoyl-phosphate synthase small chain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 502.1 0.3 4.1e-155 4.1e-155 1 360 [. 6 365 .. 6 366 .. 0.97 Alignments for each domain: == domain 1 score: 502.1 bits; conditional E-value: 4.1e-155 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk 69 a+lvle+G+v++g++fg+ +e+ GevvFnT++tGYqEi+tDpsY+gq+vv+typlignygvn++daes+ lcl|NCBI__GCF_000020625.1:WP_012506650.1 6 AKLVLENGSVYTGYAFGHIGETGGEVVFNTALTGYQEIVTDPSYAGQMVVMTYPLIGNYGVNQSDAESQ 74 579****************************************************************** PP TIGR01368 70 kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeel 138 ki++++l+v+e+s+ sn+ a+ sL+++lke ++++++g+DTR+lv+++R+kg+m++vis+ + ++++l lcl|NCBI__GCF_000020625.1:WP_012506650.1 75 KIWASALIVREMSNIHSNFAATGSLDQYLKEAKVMGLAGIDTRKLVREIRQKGAMRGVISAIDPDEKRL 143 ********************************************************************* PP TIGR01368 139 vekakespkvkevnlvkevstkeayeleqkakkegkklrvvvidlGvKenilreLvkrgvevtvvpadt 207 +eka + p++++++lvk+vst+++y++ ++ +++vv++d+G+K+nilr+L++ +++vtv++a+t lcl|NCBI__GCF_000020625.1:WP_012506650.1 144 EEKALKIPEMTGLDLVKKVSTSQTYTIDC----DDAEYHVVAYDYGIKQNILRMLQNAKCKVTVLNANT 208 *************************9995....677789****************************** PP TIGR01368 208 saeeikklnpdgillsnGPGdPaaveeaietvkkllea.....kiPifGIclGhqllalalgaktyklk 271 ++ee kl+pdgi+lsnGPGdP av++ai+++kkl+e+ +P+fGIclGhql++la+gaktyklk lcl|NCBI__GCF_000020625.1:WP_012506650.1 209 PIEEALKLDPDGIFLSNGPGDPFAVTYAIDNIKKLAEHntqqkPVPLFGICLGHQLMSLAFGAKTYKLK 277 ***********************************99766655689*********************** PP TIGR01368 272 fGhrGaNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPe 340 fGh+G+Nhpvk+lk+ +eitsqNHg+av esl+ e+le+th nl+D+tveg++hk+lp+fsvQyHPe lcl|NCBI__GCF_000020625.1:WP_012506650.1 278 FGHHGSNHPVKNLKSSSIEITSQNHGFAVAMESLP-ESLEMTHLNLYDQTVEGVRHKKLPCFSVQYHPE 345 *********************************88.56******************************* PP TIGR01368 341 aspGphdteylFdefvelik 360 a+pGphd++ylF++f+ +++ lcl|NCBI__GCF_000020625.1:WP_012506650.1 346 AAPGPHDSHYLFEQFTAMMD 365 ****************9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.61 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory