Align Homoaconitase large subunit; HACN; Homoaconitate hydratase; EC 4.2.1.36 (characterized)
to candidate WP_012536243.1 AFE_RS02935 3-isopropylmalate dehydratase large subunit
Query= SwissProt::Q9ZNE0 (418 letters) >NCBI__GCF_000021485.1:WP_012536243.1 Length = 470 Score = 191 bits (484), Expect = 5e-53 Identities = 133/386 (34%), Positives = 192/386 (49%), Gaps = 55/386 (14%) Query: 69 ANLEVAKAQKEIREWGKRHGIRVFDVGRGVCHQVLIEEGLAQPGWVVVGSDSHSTTYGAV 128 + L+V + E+G + D +G+ H + E+GL PG VV DSH+ T+GA+ Sbjct: 80 SRLQVDTLDRNCAEFGIEE-FGMHDKRQGIVHVIAPEQGLTLPGMTVVCGDSHTATHGAL 138 Query: 129 GAFGTGMGATDIALAAASGRTWLRVPESVKVVFRGRLPKGVTAKDAALEMVRLLTAEGAT 188 GA G+G T++ A+ W R S+++ G L GVTAKD L ++ + G T Sbjct: 139 GALAFGIGTTEVEHVLATQCLWARKSRSMRIWVEGELGNGVTAKDLVLAIIGRIGTAGGT 198 Query: 189 YMAVEIHLLDGAEALTRGERMTLANLTVEAGAKAGLV---------------VPSGEILE 233 A+E AL+ RMTL N+ +EAGA++G+V P G+I + Sbjct: 199 GYAIEF-AGPAVHALSVEGRMTLCNMAIEAGARSGMVGVDAVTIDYLRGRPYAPVGKIWD 257 Query: 234 MYRVPDW--LYPDPDARYAKEVEIDLSALTPRVS--------------VP---------- 267 V W L+ DPDA++ E+ ++ + + P+V+ VP Sbjct: 258 Q-AVAVWGELHSDPDAQFDAEIRLEATDVAPQVTWGTSPEMVVDISARVPDPALEKDPVR 316 Query: 268 --------FYVDNVHEVAQVKGKRVDQVFIGTCTNGRIEDLRAAAEVLRGRKVAPWVR-L 318 Y+D + + +D+VFIG+CTN RIEDLRAAA V RG A V+ + Sbjct: 317 RKGWSDALAYMD-LAAATPISSIALDKVFIGSCTNARIEDLRAAAAVARGHHKAASVKAV 375 Query: 319 LVVPASSQVLEEAARDGTLLTLLEAGATIGTPGCGPCMGRHMGVLAPGEVCVSTSNRNFR 378 LVVP S V +A +G +AG PGC C+ + L PGE C STSNRNF Sbjct: 376 LVVPGSGLVKAQAEAEGLDRIFRDAGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFE 435 Query: 379 GRMGAPDAEIYLASPRVAAASAVAGY 404 GR GA +L SP +AAA+A+AG+ Sbjct: 436 GRQGA-GGRTHLVSPAMAAAAAIAGH 460 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 490 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 470 Length adjustment: 32 Effective length of query: 386 Effective length of database: 438 Effective search space: 169068 Effective search space used: 169068 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory