Align Beta-phenylalanine transaminase; Aromatic beta-amino acid aminotransferase; Beta-phenylalanine aminotransferase; VpAT; EC 2.6.1.- (characterized)
to candidate WP_012537706.1 AFE_RS15145 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::H8WR05 (434 letters) >NCBI__GCF_000021485.1:WP_012537706.1 Length = 430 Score = 222 bits (566), Expect = 2e-62 Identities = 136/368 (36%), Positives = 189/368 (51%), Gaps = 20/368 (5%) Query: 50 PLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIEAMQGGINLTGHNLLE 109 P+ I EG WD +G RY D++ + ++GH PE+ AV + G+ +E Sbjct: 34 PIFIDHAEGPFFWDVEGKRYLDYVGSWGPMIHGHGHPEVLAAVHAQVNKGLGFGAPTAIE 93 Query: 110 GRLARLICERFPQIEQLRFTNSGTEANLMALTAALHFTGRRKIVVFSGGYHG-------- 161 +A L+C P IE +R T+SGTEA + A+ A +TGR +I+ F G YHG Sbjct: 94 VEMAELVCALVPGIESVRMTSSGTEAVMTAIRLARGYTGRDRIIKFEGNYHGHSDSLLVK 153 Query: 162 ---GVLGFGARPSPTTVPFDF----LVLPYNDAQTARAQIERHGPEIAVVLVEPMQGASG 214 G L G +PS VP + LVLPYND + + G ++A ++VEP+ G G Sbjct: 154 AGSGALTLG-QPSSAGVPREVSQNTLVLPYNDLPAVVEMMAQFGFDVATIIVEPVAGNMG 212 Query: 215 CIPGQPDFLQALRESATQVGALLVFDEVMTS-RLAPHGLANKLGIRSDLTTLGKYIGGGM 273 C+P +P FL+ LR Q G +L+FDEVMT R+A G G+R DLTTLGK IGGG+ Sbjct: 213 CVPPEPGFLEGLRAVCDQYGCVLIFDEVMTGFRVALGGAQALYGVRPDLTTLGKIIGGGL 272 Query: 274 SFGAFGGRADVMALFDPRTGPLAHSGTFNNNVMTMAAGYAGLTKLFTPEAAGALAERGEA 333 GA GG ++M P TGP+ +GT + N + MAAG A L L P LA + Sbjct: 273 PVGAVGGPREIMEYLAP-TGPVYQAGTLSGNPVAMAAGLATLRLLTVPGFHERLAAQTAV 331 Query: 334 LRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRSSEDLAAVDGRLRQLLFFH-LLNED 392 L L GV MQ + + F + VR + + A D + R FFH LL Sbjct: 332 LCEGLAERAEAAGVPMQINHVPGMFGWFFAEQPVRGFDTVMAADSK-RYARFFHGLLARG 390 Query: 393 IYSSPRGF 400 +Y +P + Sbjct: 391 VYLAPSAY 398 Lambda K H 0.322 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 483 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 430 Length adjustment: 32 Effective length of query: 402 Effective length of database: 398 Effective search space: 159996 Effective search space used: 159996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory