Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate WP_012540425.1 KVAR_RS01760 aminodeoxychorismate synthase component 2
Query= BRENDA::P20576 (201 letters) >NCBI__GCF_000025465.1:WP_012540425.1 Length = 187 Score = 256 bits (655), Expect = 1e-73 Identities = 130/192 (67%), Positives = 153/192 (79%), Gaps = 5/192 (2%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 M+L+IDNYDSFT+NL QYF EL AEV V RND L++E+I ALAPE+IV+SPGPCTPNEAG Sbjct: 1 MILLIDNYDSFTWNLYQYFCELGAEVLVRRNDALTLEEIAALAPEKIVISPGPCTPNEAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 +SLAVI +AGK PLLGVCLGHQ+I QAFG +VRA QVMHGKTS I H GVF GL N Sbjct: 61 ISLAVIRHYAGKTPLLGVCLGHQAIAQAFGATIVRAAQVMHGKTSLIEHNGEGVFQGLNN 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 PLTVTRYHSLV+ +LP VTA + A EIMG+RH+ ++EGVQFHPESIL+E Sbjct: 121 PLTVTRYHSLVIDPPTLPPEFIVTARSASA-----EIMGIRHRAWDLEGVQFHPESILSE 175 Query: 181 QGHELLANFLRQ 192 QGH+LL NFL++ Sbjct: 176 QGHQLLENFLKR 187 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 187 Length adjustment: 20 Effective length of query: 181 Effective length of database: 167 Effective search space: 30227 Effective search space used: 30227 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
Align candidate WP_012540425.1 KVAR_RS01760 (aminodeoxychorismate synthase component 2)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00566.hmm # target sequence database: /tmp/gapView.12875.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00566 [M=192] Accession: TIGR00566 Description: trpG_papA: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-93 295.6 0.0 8.9e-93 295.4 0.0 1.0 1 lcl|NCBI__GCF_000025465.1:WP_012540425.1 KVAR_RS01760 aminodeoxychorismat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025465.1:WP_012540425.1 KVAR_RS01760 aminodeoxychorismate synthase component 2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 295.4 0.0 8.9e-93 8.9e-93 1 192 [] 1 187 [] 1 187 [] 0.99 Alignments for each domain: == domain 1 score: 295.4 bits; conditional E-value: 8.9e-93 TIGR00566 1 mvllidnydsftynlvqlleelgaevvvkrndsltlqeieallpllsivisPGPctPdeaaisslelie 69 m+llidnydsft+nl+q+++elgaev+v+rnd+ltl+ei al+p++ ivisPGPctP+ea+is l++i+ lcl|NCBI__GCF_000025465.1:WP_012540425.1 1 MILLIDNYDSFTWNLYQYFCELGAEVLVRRNDALTLEEIAALAPEK-IVISPGPCTPNEAGIS-LAVIR 67 79********************************************.****************.***** PP TIGR00566 70 hlaGklPilGvClGhqalaqafGadvvraekvkhGkvseiehngaavfaglfnPdalkatryhslvvea 138 h+aGk P+lGvClGhqa+aqafGa +vra++v+hGk+s iehng++vf+gl nP l++tryhslv+++ lcl|NCBI__GCF_000025465.1:WP_012540425.1 68 HYAGKTPLLGVCLGHQAIAQAFGATIVRAAQVMHGKTSLIEHNGEGVFQGLNNP--LTVTRYHSLVIDP 134 ******************************************************..************* PP TIGR00566 139 etldtllevtaleeeeieimairhrdlpleGvqfhPesilselGkellanflkr 192 tl+ + vta + + eim+irhr+++leGvqfhPesilse+G++ll+nflkr lcl|NCBI__GCF_000025465.1:WP_012540425.1 135 PTLPPEFIVTARSASA-EIMGIRHRAWDLEGVQFHPESILSEQGHQLLENFLKR 187 ***********99998.***********************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (192 nodes) Target sequences: 1 (187 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.94 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory