Align phosphoserine phosphatase; EC 3.1.3.3 (characterized)
to candidate WP_012542919.1 KVAR_RS21965 phosphoserine phosphatase SerB
Query= CharProtDB::CH_024035 (322 letters) >NCBI__GCF_000025465.1:WP_012542919.1 Length = 323 Score = 566 bits (1458), Expect = e-166 Identities = 286/323 (88%), Positives = 303/323 (93%), Gaps = 1/323 (0%) Query: 1 MPN-ITWCDLPEDVSLWPGLPLSLSGDEVMPLDYHAGRSGWLLYGRGLDKQRLTQYQSKL 59 MPN +TWCDLPEDVSLWPGLPLSLSGDEVMPLDYHAGRSGWLLYGRGL+K+RLT +Q +L Sbjct: 1 MPNSLTWCDLPEDVSLWPGLPLSLSGDEVMPLDYHAGRSGWLLYGRGLNKRRLTDWQREL 60 Query: 60 GAAMVIVAAWCVEDYQVIRLAGSLTARATRLAHEAQLDVAPLGKIPHLRTPGLLVMDMDS 119 GAA+VIVA+W VEDYQVIRLAGSLT RATRLAHEA LDVAPLGKIPHLRTPGLLVMDMDS Sbjct: 61 GAALVIVASWVVEDYQVIRLAGSLTPRATRLAHEAGLDVAPLGKIPHLRTPGLLVMDMDS 120 Query: 120 TAIQIECIDEIAKLAGTGEMVAEVTERAMRGELDFTASLRSRVATLKGADANILQQVREN 179 TAIQIECIDEIAKLAGTGE+V+EVTERAMRGELDFTASLR RVATLK ADA IL QVR+ Sbjct: 121 TAIQIECIDEIAKLAGTGELVSEVTERAMRGELDFTASLRQRVATLKDADATILLQVRDA 180 Query: 180 LPLMPGLTQLVLKLETLGWKVAIASGGFTFFAEYLRDKLRLTAVVANELEIMDGKFTGNV 239 LPLMPGL QLVLKLETLGWKVAIASGGFTFFAEYLRDKL L AV ANELEI DGK TGNV Sbjct: 181 LPLMPGLAQLVLKLETLGWKVAIASGGFTFFAEYLRDKLHLDAVFANELEIRDGKLTGNV 240 Query: 240 IGDIVDAQYKAKTLTRLAQEYEIPLAQTVAIGDGANDLPMIKAAGLGIAYHAKPKVNEKA 299 +GDIVDA+YKA TL +LA++YEIP AQTVAIGDGANDLPMIKAAGLGIAYHAKPKVNE+A Sbjct: 241 LGDIVDAKYKANTLRKLAEKYEIPTAQTVAIGDGANDLPMIKAAGLGIAYHAKPKVNEQA 300 Query: 300 EVTIRHADLMGVFCILSGSLNQK 322 EVTIRHADLMGVFCILSGS+NQK Sbjct: 301 EVTIRHADLMGVFCILSGSMNQK 323 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 432 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 323 Length adjustment: 28 Effective length of query: 294 Effective length of database: 295 Effective search space: 86730 Effective search space used: 86730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_012542919.1 KVAR_RS21965 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.23434.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-97 309.7 0.0 6.5e-97 309.4 0.0 1.1 1 lcl|NCBI__GCF_000025465.1:WP_012542919.1 KVAR_RS21965 phosphoserine phosp Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025465.1:WP_012542919.1 KVAR_RS21965 phosphoserine phosphatase SerB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 309.4 0.0 6.5e-97 6.5e-97 1 219 [] 98 316 .. 98 316 .. 0.99 Alignments for each domain: == domain 1 score: 309.4 bits; conditional E-value: 6.5e-97 TIGR00338 1 diakselskllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkll 69 d+a + + ++l++ +l+v+D+Dst+i++E+IdeiaklaG++e Vse+TerAmrgeldF++slr+Rv++l lcl|NCBI__GCF_000025465.1:WP_012542919.1 98 DVAPLGKIPHLRTPGLLVMDMDSTAIQIECIDEIAKLAGTGELVSEVTERAMRGELDFTASLRQRVATL 166 578888999************************************************************ PP TIGR00338 70 kglpvellkkveeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgk 138 k++++ +l +v++ l+l++G+ +lv kL++ g+kva++SGgF+++ae+l++kL+ldavfaN+Le++dgk lcl|NCBI__GCF_000025465.1:WP_012542919.1 167 KDADATILLQVRDALPLMPGLAQLVLKLETLGWKVAIASGGFTFFAEYLRDKLHLDAVFANELEIRDGK 235 ********************************************************************* PP TIGR00338 139 ltGkvegeivdesakaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadivi 207 ltG+v g+ivd+++ka+tl kl+ek++i++++tva+GDGanDl+mikaAglgia++akp+++e+a+++i lcl|NCBI__GCF_000025465.1:WP_012542919.1 236 LTGNVLGDIVDAKYKANTLRKLAEKYEIPTAQTVAIGDGANDLPMIKAAGLGIAYHAKPKVNEQAEVTI 304 ********************************************************************* PP TIGR00338 208 ekkdltdilell 219 +++dl++++++l lcl|NCBI__GCF_000025465.1:WP_012542919.1 305 RHADLMGVFCIL 316 **********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (323 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 12.56 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory