Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_012565343.1 RC1_RS00445 indole-3-glycerol phosphate synthase TrpC
Query= BRENDA::P00909 (453 letters) >NCBI__GCF_000016185.1:WP_012565343.1 Length = 270 Score = 169 bits (427), Expect = 1e-46 Identities = 110/262 (41%), Positives = 150/262 (57%), Gaps = 8/262 (3%) Query: 1 MMQTVLAKIVADKAIWVEARKQQQPLASFQNEVQ--PSTRHFYDALQGA----RTAFILE 54 M VLA+I ADK V ++ +PLA+ + + P+ R F AL A R I E Sbjct: 1 MSADVLARICADKREHVARCRRDRPLAAVEAAARAAPAPRGFARALDAAVAAGRHGLIAE 60 Query: 55 CKKASPSKGVIRDDFDPARIAAIYK-HYASAISVLTDEKYFQGSFNFLPIVSQIAPQPIL 113 KKASPSKG+IR DFDP +A Y A+ +SVLTD YFQG +L P P L Sbjct: 61 IKKASPSKGLIRPDFDPPALARAYLVGGATCLSVLTDIPYFQGDDRYLEAARAAVPLPAL 120 Query: 114 CKDFIIDPYQIYLARYYQADACLLMLSVLDDDQYRQLAAVAHSLEMGVLTEVSNEEEQER 173 KDF+++PYQI +R AD LL+++ LDD Q +L A A M VL EV +E E ER Sbjct: 121 RKDFMLEPYQIVESRALGADCILLIMAALDDGQAAELYAAAIHYGMDVLVEVHDEAEMER 180 Query: 174 AIALGAKVVGINNRDLRDLSIDLNRTRELAPKLGHNVTVISESGINTYAQVRELSHF-AN 232 A+AL ++G+NNR+L+ L++DL T LA + +++ESGI A + L+ A Sbjct: 181 ALALPGGLLGVNNRNLKTLAVDLATTEGLAAMVPPGRALVAESGIYGPADIARLAAVGAR 240 Query: 233 GFLIGSALMAHDDLHAAVRRVL 254 FL+G +LM D+ AA R +L Sbjct: 241 RFLVGESLMRQADVTAATRALL 262 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 453 Length of database: 270 Length adjustment: 29 Effective length of query: 424 Effective length of database: 241 Effective search space: 102184 Effective search space used: 102184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory