Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_012565355.1 RC1_RS00500 3-deoxy-8-phosphooctulonate synthase
Query= BRENDA::Q9WYH8 (338 letters) >NCBI__GCF_000016185.1:WP_012565355.1 Length = 280 Score = 118 bits (295), Expect = 2e-31 Identities = 87/265 (32%), Positives = 138/265 (52%), Gaps = 28/265 (10%) Query: 95 FTIIAGPCSVEGREMLMETAHFLSELGVKVLRGGAYKP------RTSPYSFQGLG-EKGL 147 FT+IAGPC +E R+ +E + L E+ ++ G YK RTS + +GLG EK L Sbjct: 20 FTLIAGPCQLESRQHALEMSGALVEITRRLGIGLIYKTSFDKANRTSVSTARGLGMEKSL 79 Query: 148 EYLREAADKYGMYVVTEALGEDDLPKVAEYADIIQIGARNAQNFRLLSKAGSYNKPVLLK 207 L E + +G+ V+T+ + VAE D++QI A + LL AG +PV +K Sbjct: 80 PILAEVRETFGIPVLTDVHAPEQCAAVAEVVDVLQIPAFLCRQTDLLLAAGETGRPVNVK 139 Query: 208 RGFMNTIEEFLLSAEYIANSGNTKIILCERGIRTFEKATRNTL--DISAVPIIRKESHLP 265 +G + A IA++GN I+LCERG NTL D+ ++PI+ + P Sbjct: 140 KGQFLAPWDMKNVAAKIASTGNDNILLCERGA----SFGYNTLVSDMRSLPIMAATGY-P 194 Query: 266 ILVDPSHS-----------GGRRDLVIPLSRAAIAVGAHGIIVEVHPEPEKALSDGKQSL 314 ++ D +HS GG+R+ V L+RAA+A+G + +E H +P+ A SDG + Sbjct: 195 VVFDATHSVQQPGGQGTSSGGQREFVPVLARAAVAIGVAAVFMETHQDPDHAPSDGPNMV 254 Query: 315 ---DFELFKELVQEMKKLADALGVK 336 + E E++ + ++A A V+ Sbjct: 255 PVSELESILEVMVALDRIAKAAPVR 279 Lambda K H 0.318 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 280 Length adjustment: 27 Effective length of query: 311 Effective length of database: 253 Effective search space: 78683 Effective search space used: 78683 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory