Align Putative [LysW]-L-2-aminoadipate/[LysW]-L-glutamate phosphate reductase; EC 1.2.1.103; EC 1.2.1.106 (uncharacterized)
to candidate WP_012566503.1 RC1_RS06260 N-acetyl-gamma-glutamyl-phosphate reductase
Query= curated2:A8AAF8 (356 letters) >NCBI__GCF_000016185.1:WP_012566503.1 Length = 350 Score = 244 bits (624), Expect = 2e-69 Identities = 142/352 (40%), Positives = 200/352 (56%), Gaps = 11/352 (3%) Query: 5 VAIVGASGYTGGELLRVLAVHPDVNVKVVTSREYANKPVYYAHPHLRGIYPASLKFKRLD 64 VA++GASGYTG EL+R+L HP +++V+T A KPV PHL ++ + R+D Sbjct: 10 VAVLGASGYTGAELMRLLVRHPRTSIRVLTGERQAGKPVAEVFPHL--MHEDLPRLCRID 67 Query: 65 DPDQLSDVVGDVDLVFLALPHKVSLHYVPKALEVGYKVVDLSADYRLKRVEDYKTWYGYE 124 + D +DLVF ALPH + + L KVVDLSAD+RL VE Y WYG+ Sbjct: 68 EVDW-----SGIDLVFCALPHGTTQEVIA-GLPATLKVVDLSADFRLADVETYAQWYGHA 121 Query: 125 HPYPDLLEKAVYGLPELYGDKIRGAQLVANPGCNATSSILAVLPPAAERIIDLDRIVVDV 184 H P+L +AVYGL E+ +RGA+LVANPGC T++ L ++P +++ D I++D Sbjct: 122 HRAPELQREAVYGLCEINRQGVRGARLVANPGCYPTAAQLPLIPLLLRDLVETDDIIIDA 181 Query: 185 KVGSSEAGAKPYRGGHHPEREGTARPYDAEGHRHVAELEQVIRDYTGRDVKVGFTPHAVS 244 K G S AG + E Y HRH E+EQ + GR V V FTPH + Sbjct: 182 KSGVSGAGRDAKQANLFGEVAEGIHAYGIASHRHAPEIEQGLSLAAGRTVMVNFTPHLMP 241 Query: 245 MIRGSLASAYSWLTKDLAPLDVQRIYAKYYAGKKFVKIVRGAPMPYPDVKNVYGSNYAEV 304 M RG L S Y + + D++ A+ YAG+ F K++ P ++V GSN + Sbjct: 242 MTRGILTSIYVRMKPGVTAADLRAALAEQYAGEPFAKVLPEGVA--PQTRHVRGSNLCLM 299 Query: 305 GFALDKRVGRLAMFAAIDNLMKGAAGTAVQNMNLMLGMDEDEGLKNLVPVRP 356 D+ GR + +AIDNL+KGA+G A+QNMNL+ G+DE GL+ +VP+ P Sbjct: 300 NAFADRLPGRAIVLSAIDNLVKGASGQAIQNMNLLYGLDERTGLE-VVPLFP 350 Lambda K H 0.319 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 350 Length adjustment: 29 Effective length of query: 327 Effective length of database: 321 Effective search space: 104967 Effective search space used: 104967 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory