Align O-succinylhomoserine sulfhydrylase (EC 2.5.1.48) (characterized)
to candidate WP_012566511.1 RC1_RS06305 O-acetylhomoserine aminocarboxypropyltransferase
Query= reanno::HerbieS:HSERO_RS16440 (413 letters) >NCBI__GCF_000016185.1:WP_012566511.1 Length = 437 Score = 248 bits (633), Expect = 3e-70 Identities = 155/431 (35%), Positives = 233/431 (54%), Gaps = 25/431 (5%) Query: 1 MNDKKTYGFTTTILHSDRQKGIEHGSLHKPIHTSVTFGYEDARQLAEVFQGKQPGYRYGR 60 M+D ++ GF T +H+ G+ PI+ + ++ ++D A +F ++ G+ Y R Sbjct: 1 MSDSRSSGFETRAIHAGAAPDPTTGARATPIYQTTSYVFDDVEDAAALFNLEKVGFIYSR 60 Query: 61 QGNPTVAALEDKITKMEDGKSTICFATGMAAIGAIVQGLLREGDHVVSSAFLFGNTNSLW 120 NPTV+ LE ++ +E G C ++G AA + LL GD +V+S L+G T + + Sbjct: 61 LTNPTVSVLEARLADLEGGAGATCTSSGHAAQLLALFPLLTPGDEIVASRQLYGGTLNQF 120 Query: 121 MTV--GAQGAKVSMVDATDVKNVEAAITANTRLVFVETIANPRTQVADLKRIGELCRERG 178 A G K VD+ D +N A+T T+ +F+E++ANP V D++ I + G Sbjct: 121 ANSFPRAFGWKTVFVDSDDPENFRRALTPKTKAIFIESLANPGGVVLDIEAIARIADGAG 180 Query: 179 ILYVVDNTMTSPYLFRPKTVGAGLVVNSLTKSIGGHGNALGGALTDTGEFDWT---RYPH 235 I +VDNT+ +PYL RP GA LVV+S TK +GGHGN++GG + D+G FDW+ R+P Sbjct: 181 IPLIVDNTLATPYLCRPLDHGATLVVHSTTKFLGGHGNSVGGVVIDSGRFDWSKDGRFPA 240 Query: 236 IAENYKKNPAPQWGMAQIRAK-------------ALRDFGGSLGPEAAHHIAVGAETIAL 282 ++E P P + + A LRD G S P A G ET+AL Sbjct: 241 LSE-----PEPGYHGMRFHATFGALAFTIHGHAIGLRDLGPSQAPLNAFLTLTGIETLAL 295 Query: 283 RQERECKNALALAQMLQADERVAAVYYPGLESHPQHALS-KALFRSFGSLMSFELKDGID 341 R ER NALA+AQ L+ VA V Y GL HAL+ K L R GS+ +F LK G + Sbjct: 296 RMERHSANALAVAQHLKQHPAVAWVNYAGLPDSRYHALARKYLPRGAGSVFTFGLKGGYE 355 Query: 342 C-FDYLNRLRLAIPTSNLGDTRTLVIPVAHTIFYEMGAERRASMGIAESLIRVSVGLEDT 400 + ++L +N+GDTR+L+I A T ++ E A+ G ++R+SVG+E Sbjct: 356 AGVKLVESVKLFSHLANIGDTRSLIIHPASTTHSQLSPEGLAAAGAGPDVVRLSVGIESV 415 Query: 401 DDLVADFRQAL 411 +D++AD QAL Sbjct: 416 EDIIADLDQAL 426 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 437 Length adjustment: 32 Effective length of query: 381 Effective length of database: 405 Effective search space: 154305 Effective search space used: 154305 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory