Align Homocysteine/cysteine synthase; O-acetylserine/O-acetylhomoserine sulfhydrylase; OAS-OAH SHLase; OAS-OAH sulfhydrylase; EC 2.5.1.47; EC 2.5.1.49 (characterized)
to candidate WP_012566511.1 RC1_RS06305 O-acetylhomoserine aminocarboxypropyltransferase
Query= SwissProt::P06106 (444 letters) >NCBI__GCF_000016185.1:WP_012566511.1 Length = 437 Score = 382 bits (981), Expect = e-110 Identities = 203/436 (46%), Positives = 279/436 (63%), Gaps = 15/436 (3%) Query: 3 SHFDTVQLHAGQENPGDNAHRSRAVPIYATTSYVFENSKHGSQLFGLEVPGYVYSRFQNP 62 S F+T +HAG D +RA PIY TTSYVF++ + + LF LE G++YSR NP Sbjct: 7 SGFETRAIHAGAAP--DPTTGARATPIYQTTSYVFDDVEDAAALFNLEKVGFIYSRLTNP 64 Query: 63 TSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFKISF 122 T +VLE R+A LEGGA A SSG AAQ LA+ L GD IV++ LYGGT NQF SF Sbjct: 65 TVSVLEARLADLEGGAGATCTSSGHAAQLLALFPLLTPGDEIVASRQLYGGTLNQFANSF 124 Query: 123 KR-FGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVV 181 R FG + FV+ D+PE F + +TKA+++E++ NP V D E I IA GIP++ Sbjct: 125 PRAFGWKTVFVDSDDPENFRRALTPKTKAIFIESLANPGGVVLDIEAIARIADGAGIPLI 184 Query: 182 VDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFS 241 VDNT A Y C+P+ +GA +V HS TK++GGHG ++GG+++DSG+F W +FP S Sbjct: 185 VDNTL-ATPYLCRPLDHGATLVVHSTTKFLGGHGNSVGGVVIDSGRFDWSK-DGRFPALS 242 Query: 242 QPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLRAERHGE 301 +P GYHG ++ +G LA+ +H LRDLGP P +FL L G+ETL+LR ERH Sbjct: 243 EPEPGYHGMRFHATFGALAFTIHGHAIGLRDLGPSQAPLNAFLTLTGIETLALRMERHSA 302 Query: 302 NALKLAKWLEQSPYVSWVSYPGLASHSHHENAKKYLSNGFGGVLSFGVKDLPNADKETDP 361 NAL +A+ L+Q P V+WV+Y GL +H A+KYL G G V +FG+K A Sbjct: 303 NALAVAQHLKQHPAVAWVNYAGLPDSRYHALARKYLPRGAGSVFTFGLKGGYEA------ 356 Query: 362 FKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGI 421 G ++V+++KL S+LAN+GD ++L+I P TTH QL+ + A+G D++R+SVGI Sbjct: 357 ----GVKLVESVKLFSHLANIGDTRSLIIHPASTTHSQLSPEGLAAAGAGPDVVRLSVGI 412 Query: 422 EFIDDIIADFQQSFET 437 E ++DIIAD Q+ T Sbjct: 413 ESVEDIIADLDQALAT 428 Lambda K H 0.317 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 437 Length adjustment: 32 Effective length of query: 412 Effective length of database: 405 Effective search space: 166860 Effective search space used: 166860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory