Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate WP_012567061.1 RC1_RS09020 pyridoxal phosphate-dependent aminotransferase
Query= curated2:B1I544 (392 letters) >NCBI__GCF_000016185.1:WP_012567061.1 Length = 401 Score = 186 bits (472), Expect = 1e-51 Identities = 132/393 (33%), Positives = 186/393 (47%), Gaps = 17/393 (4%) Query: 6 AKRIRNLPPYLFARIEQLIADKKAQGVDVISLGIGDPDVPTPDHIIEAAEKELKIPANHQ 65 A R+ + P + KA G DVI LG G+PD TPD I +AA + ++ + Sbjct: 5 ASRLSRIKPSATIAVTSKARALKAAGRDVIGLGAGEPDFDTPDSIKDAAIEAIRRGFT-K 63 Query: 66 YPSSAGMPAYRRAVADWYARRFGVELDPQREVVSLIGSKEGIAHLPWCFVDPGDVVLVPD 125 Y G P ++AVA + R G+E DP ++ G K+ + + +DPGD V+VP Sbjct: 64 YTDVDGTPELKKAVAAKFRRDNGLEYDPATQITVGTGGKQVLFNALLATLDPGDEVIVPA 123 Query: 126 PGYPVYAGGTILAGGIPHPVPLTAGNGFLPDLAAIPAETARRAKVMFINYPNNPTGAV-A 184 P + Y +LA G P PV A GF AA+ A R K + +N P+NPTGA Sbjct: 124 PYWVSYPDMVLLAEGTPVPVACPAEAGFKLTPAALEAAITPRTKWLILNSPSNPTGAAYT 183 Query: 185 SKEFFARVVDFAREYGILVCHDAAYSEIAFDGYRPPSFLEVA-GAREVGIEFHSVSKTYN 243 + E A R + V D Y + +DG+R + +V G + + VSK Y+ Sbjct: 184 AAELTALGEVLLRHPQVWVMSDDMYEHLVYDGFRFATIAQVVPGLLGRTLTVNGVSKAYS 243 Query: 244 MTGWRAGWAAGNAGAVEALGRLKSNLDSGVFQVVQYAAIAALNGPQDGVQSLCEMYRERR 303 MTGWR G+A G ++A+G ++S S + Q AA ALNGPQD + E++ RR Sbjct: 244 MTGWRIGFAGGPKELIKAMGVIQSQSTSNPTSISQAAATEALNGPQDYIPRQAEVFARRR 303 Query: 304 DLVVDTLNDL-GWRLTRPRATFYIW--------APVPAGHDASS---FAEMVLEKAGVVI 351 DLVV LN G P FY++ P G S FA +LE GV + Sbjct: 304 DLVVSMLNQAKGLSCPNPEGAFYVYPSCAATLGLSTPGGRVIGSDEDFATELLEAEGVAV 363 Query: 352 TPGTGYGTYGEGYFRISLTLPTPRLVEAMERLR 384 G +G +FRIS L EA R++ Sbjct: 364 VHGAAFGL--SPHFRISYATSETVLEEACRRIQ 394 Lambda K H 0.321 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 401 Length adjustment: 31 Effective length of query: 361 Effective length of database: 370 Effective search space: 133570 Effective search space used: 133570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory